Recombinant Liza aurata Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributor.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its implementation.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Liza aurata (Golden grey mullet)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILIGFPVNFLTLY VTIEHKKLRTPLNYILLNLAVADLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIALWSLVVLAVERWMVVCKPISNFRFGEDHAIMGLAFTWVMAAACAVPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVSRMVVIMVVAFLVCWCPYAGVAWYIFTHQGSEFGPLFMTFPAFFAKSSSI YNPMIYICMNKQFRQCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor essential for image-forming vision in low light conditions. While most saltwater fish species utilize retinal as a chromophore, freshwater fish primarily employ 3-dehydroretinal or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling through G-proteins. Subsequent receptor phosphorylation facilitates displacement of the bound G-protein alpha subunit by arrestin, thereby terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What is Rhodopsin and its Role in Visual Function?

Rhodopsin is a G protein-coupled receptor and the primary photoreceptor protein found in rod cells of the retina. It consists of the protein component opsin and a covalently bound chromophore, 11-cis-retinal. When light activates rhodopsin, it triggers a conformational change that initiates the visual transduction cascade . In vertebrates like Liza aurata (golden grey mullet), rhodopsin plays a crucial role in dim-light vision, with spectral absorbance peaks typically around 500 nm, though this can vary between species .

How Do Mutations in Rhodopsin Affect Visual Function?

Mutations in the rhodopsin gene (RHO) are among the most common genetic causes of autosomal dominant retinitis pigmentosa (adRP), accounting for approximately 30% of adRP cases . These mutations can lead to protein misfolding, altered trafficking, and formation of insoluble aggregates, resulting in photoreceptor degeneration and progressive vision loss . For example, the P23H mutation causes rhodopsin misfolding that leads to endoplasmic reticulum stress and ultimately photoreceptor death .

What Experimental Models Are Available for Studying Recombinant Rhodopsin?

Several experimental models are used to study recombinant rhodopsin:

  • Cell culture systems: COS-7 and HEK293T cells are commonly used for expressing recombinant rhodopsin for structural and functional studies

  • Transgenic rodent models: P23H rhodopsin transgenic rats and mice with various rhodopsin mutations serve as disease models

  • Humanized mouse models: Mice expressing human rhodopsin genes with specific mutations provide models that closely mimic human disease conditions

  • In vitro reconstitution systems: Purified recombinant rhodopsin can be reconstituted with various retinal isomers for spectroscopic and biochemical analyses

What Spectroscopic Methods Are Used to Characterize Rhodopsin Properties?

Spectroscopic analyses are fundamental for characterizing rhodopsin's photochemical properties:

  • Absorption spectroscopy: Measures the wavelength-specific light absorption of rhodopsin, typically showing a characteristic peak (λmax) around 500 nm for wild-type vertebrate rhodopsin

  • Difference spectroscopy: Monitors changes in spectral properties following light activation or during thermal reactions

  • Retinal isomer analysis: Often employing HPLC to determine the isomeric composition of retinal bound to rhodopsin before and after light exposure

These methods can identify spectral shifts that occur with mutations or under different conditions. For example, G188 mutants of bovine rhodopsin show blue-shifted absorption maxima compared to wild-type (500 nm), with one exception being G188D (509 nm) .

What Are the Optimal Expression Systems for Recombinant Liza aurata Rhodopsin?

For mammalian expression of recombinant rhodopsin, HEK293T cells offer significant advantages due to their high transfection efficiency and proper post-translational modifications. For expression, the rhodopsin cDNA can be inserted into mammalian expression vectors such as pUSRα or pCAGGS .

The optimal expression protocol typically involves:

  • Transfection of cells with the rhodopsin expression construct

  • Culture in the presence of 11-cis-retinal or all-trans-retinal depending on the experiment

  • Harvesting and solubilization of cell membranes using mild detergents

  • Purification using affinity chromatography (often utilizing epitope tags)

The G188C mutant of bovine rhodopsin, for example, demonstrates high expression yield in mammalian cultured cells while maintaining G protein activation ability, making it potentially valuable for optogenetic applications .

How Can Researchers Overcome Challenges in Expressing Mutant Rhodopsin Variants?

Expressing mutant rhodopsin variants often presents challenges such as protein misfolding, aggregation, and reduced yield. Several approaches can address these issues:

  • Temperature modulation: Lowering the incubation temperature (28-30°C) can improve folding of some mutant proteins

  • Chemical chaperones: Compounds like 4-phenylbutyric acid can stabilize some mutant rhodopsins

  • Codon optimization: Optimizing the coding sequence for the expression system can improve translation efficiency

  • Fusion partners: Adding solubility-enhancing tags or fusion partners can improve expression

  • Addition of stabilizing ligands during expression: For some mutations, adding 11-cis-retinal or retinal analogs during expression can stabilize the protein

For mutations causing protein aggregation, compounds like curcumin have shown promise in dissociating aggregates of mutant rhodopsin (such as P23H) and decreasing endoplasmic reticulum stress in cellular models .

What Methods Can Be Used to Assess the Functional Integrity of Purified Recombinant Rhodopsin?

Several complementary approaches can verify the functional integrity of purified recombinant rhodopsin:

MethodMeasurementSignificance
UV-visible spectroscopyAbsorbance spectrum (λmax)Confirms proper protein folding and chromophore binding
Light-induced bleaching assaySpectral shift upon illuminationVerifies photoreactivity
G protein activation assayGTPγS binding or GTP hydrolysisConfirms signaling capability
Thermal stability assayRate of thermal denaturationEvaluates protein stability
Meta II decay kineticsRate of active state decayMeasures signaling lifetime

Light-induced spectral changes in particular are crucial for assessing rhodopsin function. In the G188C mutant, for example, yellow light irradiation shifts the absorption spectrum into the UV region, and subsequent UV light irradiation can reincreate the visible region absorbance through retinal isomerization .

How Do Different Rhodopsin Mutations Affect Protein Trafficking and Photoreceptor Survival?

Rhodopsin mutations cause photoreceptor degeneration through several mechanisms:

  • Class I mutations: Generally affect the C-terminus and disrupt proper trafficking to the outer segment

  • Class II mutations (like P23H): Cause protein misfolding, ER retention, and activation of the unfolded protein response

  • Class III mutations: Affect post-Golgi trafficking and rhodopsin localization

  • Class IV mutations: Primarily disrupt rhodopsin stability or activation properties

The severity and progression of photoreceptor degeneration varies with different mutations. For the P23H mutation, photoreceptor degeneration in transgenic mice was significantly slower when animals were reared in darkness compared to those raised under cyclic light conditions, indicating that light activation of rhodopsin contributes to disease severity . TUNEL labeling demonstrated that cyclic light-reared animals had a threefold higher incidence of photoreceptor cell death than their dark-reared counterparts .

What Role Does Light Play in Exacerbating Rhodopsin-Related Retinal Degeneration?

Light exposure can significantly influence the progression of rhodopsin-related retinal degeneration, particularly for certain mutations:

  • For P23H rhodopsin, light activation accelerates photoreceptor degeneration

  • Dark-reared transgenic mice with P23H rhodopsin show significantly slower degeneration than those raised in cyclic light

  • Light exposure affects the regional distribution of photoreceptor death - in P23H transgenic mice, light-reared animals show greater cell death in the inferior retina (matching the pattern seen in human patients), while dark-reared animals show more uniform degeneration across the retina

These findings suggest that minimizing light exposure could potentially slow disease progression in patients with certain rhodopsin mutations. The mechanism may involve prolonged activation of misfolded rhodopsin or increased oxidative stress resulting from the light-activated visual cycle .

How Can Single Amino Acid Substitutions Dramatically Alter Rhodopsin Function?

Single amino acid substitutions can profoundly affect rhodopsin function by altering:

  • Protein folding and stability

  • Retinal binding pocket structure

  • Photochemical properties

  • G protein coupling efficiency

  • Meta II stability and decay kinetics

A striking example is the G188C mutation in bovine rhodopsin, which transforms vertebrate rhodopsin into a photocyclic pigment capable of recovering its dark state from the active state through thermal reactions and photoreactions . This single mutation creates unique properties:

  • The ability to incorporate 11-cis and 9-cis retinals when reconstituted with all-trans retinal

  • Photoreversibility through UV light exposure

  • Thermal recovery to the original dark state after photoactivation

The position 188 in rhodopsin appears critically important for determining photocycle properties, as other substitutions at this position (16 other mutations were tested) did not confer the same photocyclic properties .

What Gene Therapy Approaches Show Promise for Treating Rhodopsin Mutations?

Several gene therapy strategies have been developed for rhodopsin-related retinal degeneration:

  • Mutation-dependent approaches: Target specific mutations using ribozymes, siRNAs, or antisense oligonucleotides

  • Mutation-independent approaches: Silence both mutant and wild-type rhodopsin expression while providing a resistant replacement gene

  • Allele-specific gene editing: CRISPR/Cas9-based approaches that specifically target the mutant allele while preserving wild-type function

A comprehensive comparison of these approaches is summarized in the literature, with varying degrees of success in animal models . Recent advances in allele-specific CRISPR/Cas9-based medicine have shown particular promise, demonstrating long-term (up to 11 months) improvement of retinal function and preservation of photoreceptors in humanized mouse models .

How Effective Are Small Molecule Approaches for Treating Rhodopsin-Related Retinal Degeneration?

Small molecule approaches offer alternative therapeutic strategies for rhodopsin-related diseases:

  • Chemical chaperones: These can stabilize misfolded rhodopsin and improve trafficking

  • Compounds that dissociate protein aggregates: Curcumin has been shown to dissociate mutant rhodopsin aggregates in cell culture and improve retinal structure and function in P23H rhodopsin transgenic rats

  • Modulators of proteostasis: Compounds that enhance protein degradation or autophagy

In studies with curcumin, administration to P23H-rhodopsin transgenic rats resulted in improved retinal morphology, physiology, gene expression, and localization of rhodopsin . This suggests that compounds targeting protein aggregation may serve as potential therapeutic agents for treating retinitis pigmentosa due to the P23H rhodopsin mutation and potentially other degenerative diseases caused by protein trafficking defects .

What Methods Are Used to Evaluate Therapeutic Efficacy in Rhodopsin Disease Models?

Multiple complementary techniques are employed to comprehensively assess therapeutic efficacy:

Evaluation MethodMeasurementSignificance
Electroretinography (ERG)Retinal electrical responsesFunctional assessment of photoreceptor activity
Optical coherence tomography (OCT)Retinal layer thicknessNon-invasive structural assessment
HistologyOuter nuclear layer thickness, outer segment integrityDetailed structural analysis
TUNEL labelingApoptotic cell quantificationMeasurement of cell death processes
Rhodopsin localizationImmunohistochemistryAssessment of protein trafficking
Retinal densitometryRhodopsin levelsQuantification of functional rhodopsin
Gene expression analysismRNA levelsAssessment of transcriptional changes

In transgenic P23H rhodopsin models, these methods have revealed that therapy efficacy can be assessed by measuring parameters such as outer nuclear layer thickness, electroretinogram amplitudes, rhodopsin localization to the outer segments, and the distribution/rate of photoreceptor apoptosis .

How Should Researchers Design Light Exposure Protocols When Working with Rhodopsin Mutants?

When designing light exposure protocols for rhodopsin mutant studies, researchers should consider:

  • Light intensity standardization: Use calibrated light sources with defined intensities (e.g., foot-candles or lux)

  • Spectral composition: Define the wavelength range, as different wavelengths may affect rhodopsin mutants differently

  • Exposure duration and cycles: Clearly define light/dark cycles (e.g., 12h/12h) or constant conditions

  • Age of initiation: Consider when to begin light treatment relative to photoreceptor development

  • Controls: Include both wild-type animals and mutant animals raised in darkness as controls

In studies with P23H rhodopsin transgenic mice, animals were reared either in darkness or in cyclic light (approximately 7 foot-candle) for periods of 2, 4, or 6 months, allowing for time-course analysis of degeneration . This approach enabled researchers to determine that light deprivation significantly slowed the rate of photoreceptor degeneration in these models.

What Are the Key Considerations for Designing Recombinant Rhodopsin Constructs for Functional Studies?

When designing recombinant rhodopsin constructs:

  • Expression tags: Consider the position and type of epitope tags (N-terminal tags may affect trafficking while C-terminal tags may interfere with G protein coupling)

  • Promoter selection: Choose appropriate promoters for the expression system and desired expression level

  • Signal sequences: Include proper signal peptides for membrane insertion

  • Codon optimization: Optimize codons for the expression system

  • Mutations of interest: Precisely define the mutation position using standardized numbering systems

  • Control constructs: Include wild-type rhodopsin controls expressed under identical conditions

For mutations at position 188 of bovine rhodopsin, for example, researchers successfully detected photopigments from eight different mutants after reconstitution with 11-cis retinal, but only the G188C mutant exhibited the unique photocyclic property .

How Can Researchers Accurately Compare Wild-Type and Mutant Rhodopsin Expression Levels in Heterologous Systems?

Accurate comparison of expression levels requires:

  • Quantitative Western blotting: Use standardized loading controls and calibration curves

  • Absorption spectroscopy: For properly folded rhodopsin with bound chromophore

  • Flow cytometry: For cell-surface expression analysis

  • Radiolabeled ligand binding: For absolute quantification

  • Mass spectrometry: For precise protein quantification

When comparing expression levels, it's crucial to distinguish between:

  • Total protein expression (including misfolded protein)

  • Properly folded protein capable of chromophore binding

  • Functionally active protein capable of G protein activation

In studies of rhodopsin mutants, researchers have used these techniques to determine that treatments like curcumin can affect both the expression level and proper localization of rhodopsin in cellular and animal models .

What Are the Most Promising Research Directions for Recombinant Rhodopsin Studies?

The field of recombinant rhodopsin research offers several promising directions:

  • Development of photoswitchable rhodopsin variants as optogenetic tools: The G188C mutant of bovine rhodopsin demonstrates potential as an optogenetic tool due to its photocyclic property, high expression yield, and G protein activation ability

  • Allele-specific gene editing: CRISPR/Cas9-based approaches that specifically target mutant rhodopsin alleles while preserving wild-type function represent a promising therapeutic approach for autosomal dominant rhodopsin mutations

  • Small molecule therapeutics: Compounds like curcumin that can dissociate protein aggregates offer potential treatments for rhodopsin misfolding diseases

  • Understanding the molecular mechanisms of rhodopsin photocycling: Further research into how single amino acid substitutions can dramatically alter rhodopsin function will provide insights into the fundamental mechanisms of GPCR activation and deactivation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.