Recombinant Liza saliens Rhodopsin (rho)

Shipped with Ice Packs
In Stock

Description

Product Overview

Recombinant Liza saliens Rhodopsin (rho) is a synthetic protein derived from the Liza saliens species (leaping mullet). It is engineered for research applications, including ELISA assays, structural studies, and photoreceptor biology investigations. Key characteristics include:

ParameterValue
SpeciesLiza saliens (Leaping mullet)
UniProt IDQ9YGZ7
Tag TypeDetermined during production (not specified)
Storage BufferTris-based buffer, 50% glycerol
Storage Conditions-20°C or -80°C; avoid repeated freeze-thaw cycles
AA Sequence LengthFull-length protein (1-353 residues)

Biochemical Properties

  • Chromophore Binding: Recombinant rhodopsin binds 11-cis-retinal, forming a Schiff base with lysine residues in the seventh transmembrane domain .

  • Thermal Stability: Stabilized by 50% glycerol in Tris buffer to prevent aggregation during storage .

  • Function: Acts as a light-sensitive receptor, activating phototransduction cascades upon retinal isomerization .

Challenges and Gaps

  • Expression Host: The recombinant Liza saliens rhodopsin’s host organism (e.g., E. coli, mammalian cells) is unspecified in available data .

  • Protein Yield: No quantitative data on expression efficiency or purification yields are provided .

  • Functional Validation: Limited evidence of its use in functional assays (e.g., retinal regeneration, signaling assays) .

Comparative Analysis with Other Rhodopsins

FeatureLiza saliens Rhodopsin Mouse Rhodopsin Human Rhodopsin
Sequence Length353 aa348 aa348 aa
TagUndisclosedN-terminal His-tagNative (untagged)
Expression SystemNot specifiedE. coliMammalian cells
ApplicationsELISA, structural studiesSDS-PAGE, trafficking assaysPhototransduction research

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
rho; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-353
Protein Length
full length protein
Species
Liza saliens (Leaping mullet) (Chelon saliens)
Target Names
rho
Target Protein Sequence
MNGTEGPYFYIPMVNTTGIVRSPYEYPQYYLVNPAAYAALGAYMFLLILVGFPINFLTLY VTIEHKKLRTPLNYILLNLAVANLFMVFGGFTTTMYTSMHGYFVLGRLGCNLEGFFATLG GEIALWSLVVLAIERWMVVCKPISNFRFGEDHAIMGLAFTWVMAAACAVPPLVGWSRYIP EGMQCSCGIDYYTRAEGFNNESFVIYMFVCHFLIPLVVVFFCYGRLLCAVKEAAAAQQES ETTQRAEREVSRMVVIMVVAFLICWCPYAGVAWYIFTHQGSEFGPLFMTFPAFFAKSSSI YNPMIYICMNKQFRHCMITTLCCGKNPFEEEEGASTTSKTEASSVSSSSVSPA
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision under low light conditions. While most saltwater fish species utilize retinal as a chromophore, most freshwater fish employ 3-dehydroretinal or a combination of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling through G-proteins. Subsequent receptor phosphorylation mediates the displacement of the bound G-protein alpha subunit by arrestin, terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.

Q&A

What are the optimal storage and handling conditions for Recombinant Liza saliens Rhodopsin?

For optimal stability and activity preservation, Recombinant Liza saliens Rhodopsin should be stored at -20°C for regular use and at -20°C or -80°C for extended storage . The protein is typically supplied in a Tris-based buffer containing 50% glycerol, specifically optimized for maintaining its native conformation.

Methodology for proper handling:

  • Avoid repeated freeze-thaw cycles which can lead to protein denaturation

  • Prepare small working aliquots to be stored at 4°C for up to one week

  • Protect from light during handling to prevent unwanted photoactivation

  • Maintain cold chain integrity during all experiments

  • Consider adding protease inhibitors when working with the protein in solution for extended periods

These conditions are essential for maintaining the functional integrity of the protein for research applications .

How does the phototransduction cascade initiated by Liza saliens Rhodopsin function?

The phototransduction cascade initiated by Liza saliens Rhodopsin follows the general mechanism observed in rod photoreceptors, though with species-specific kinetics. When light is absorbed by the 11-cis-retinal chromophore bound to rhodopsin, it isomerizes to all-trans-retinal, triggering conformational changes in the protein . This activated form (R*) then couples with the G-protein transducin, catalyzing GDP/GTP exchange.

The activated transducin subsequently activates phosphodiesterase (PDE), which hydrolyzes cGMP, leading to the closure of cGMP-gated channels and hyperpolarization of the rod cell membrane . This change in membrane potential results in decreased glutamate release at the synapse and neural signaling.

The deactivation phase involves multiple steps:

  • Phosphorylation of R* by rhodopsin kinase

  • Binding of arrestin to phosphorylated R*

  • Hydrolysis of GTP by transducin

  • Regeneration of cGMP by guanylate cyclase

Calcium plays a critical regulatory role in this process, particularly through recoverin, which mediates calcium-dependent inhibition of rhodopsin phosphorylation, influencing the recovery phase of the photoresponse .

What spectroscopic methods are most effective for characterizing the photoactive properties of Recombinant Liza saliens Rhodopsin?

Multiple spectroscopic approaches provide complementary insights into the photoactive properties of Recombinant Liza saliens Rhodopsin:

UV-Visible Absorption Spectroscopy:

  • Primary method for determining absorption maximum and extinction coefficient

  • Enables monitoring of the photocycle through spectral shifts during photoactivation

  • Allows quantification of chromophore binding efficiency

Time-Resolved Spectroscopy:

  • Captures rapid conformational changes following light activation

  • Resolves intermediate photostates on microsecond to millisecond timescales

  • Enables determination of rate constants for photointermediate transitions

Resonance Raman Spectroscopy:

  • Provides detailed information about chromophore-protein interactions

  • Identifies specific vibrational modes affected by light activation

  • Distinguishes between different retinal isomerization states

Fluorescence-Based Methods:

  • FRET measurements using strategically placed fluorophores to detect conformational changes

  • Fluorescence lifetime imaging to probe protein environments

  • Single-molecule fluorescence to detect conformational heterogeneity

A comprehensive experimental approach would combine these methods with proper controls, including dark-state measurements and comparison with well-characterized rhodopsins from other species .

How can site-directed mutagenesis be leveraged to study structure-function relationships in Liza saliens Rhodopsin?

Site-directed mutagenesis represents a powerful approach for investigating the molecular basis of Liza saliens Rhodopsin function:

Strategic Target Selection:

  • Conserved residues identified through multiple sequence alignments

  • Residues in the chromophore binding pocket

  • Amino acids at G-protein interaction interfaces

  • Residues involved in conformational changes or stability

Mutation Design Strategy:

  • Conservative substitutions to probe subtle effects

  • Charge-reversal mutations to test electrostatic interactions

  • Alanine scanning to identify functionally important residues

  • Introduction of reporter groups at specific positions

Functional Characterization Framework:

  • Spectroscopic assessment of chromophore binding and photochemistry

  • Thermal stability assays to detect structural perturbations

  • G-protein activation assays to measure signaling efficiency

  • Electrophysiological recordings to assess photoresponse kinetics

Data Analysis Approach:

  • Correlation of structural alterations with functional changes

  • Comparison with equivalent mutations in other species' rhodopsins

  • Integration with computational modeling

Research on rhodopsin mutations in other species has demonstrated that mutations can affect various aspects of function, including rhodopsin activation, deactivation kinetics, and even energy metabolism in photoreceptor cells . Such approaches have revealed that substitutions at position proline 347 of rhodopsin can interfere with R* inactivation, providing a model for understanding structure-function relationships .

What experimental approaches are most effective for studying calcium-dependent regulation of Liza saliens Rhodopsin?

Calcium plays a crucial role in modulating rhodopsin function through several mechanisms. Effective experimental approaches include:

Calcium Manipulation Techniques:

  • Use of calcium buffers (EGTA, BAPTA) to control free calcium concentrations

  • Caged calcium compounds for temporal control of calcium release

  • Calcium ionophores for controlled calcium influx

Measurement Methodologies:

  • Calcium-sensitive fluorescent indicators to monitor real-time changes

  • Patch-clamp electrophysiology to correlate calcium levels with membrane currents

  • Biochemical assays for calcium-dependent protein interactions

Molecular Manipulation Approaches:

  • Introduction of recombinant recoverin to study calcium-dependent regulation

  • Mutations of calcium-binding sites in regulatory proteins

  • Pharmacological inhibition of calcium-dependent processes

Based on research with other rhodopsins, calcium-bound recoverin (Ca-recoverin) prolongs the recovery phase of bright flash responses by inhibiting rhodopsin deactivation, with calcium sensitivity in the micromolar range (Kd of approximately 13 μM) . This calcium-dependent regulation exhibits rapid kinetics, with effects diminishing quickly following calcium concentration decreases .

The experimental design should include comparisons between various calcium concentrations, with careful attention to physiologically relevant ranges for the species being studied.

What are the critical factors to consider when designing photoresponse experiments with Recombinant Liza saliens Rhodopsin?

Designing robust photoresponse experiments requires careful consideration of multiple parameters:

Light Stimulus Parameters:

  • Wavelength selection based on the absorption maximum of Liza saliens Rhodopsin

  • Precise control of light intensity using calibrated neutral density filters

  • Temporal parameters (flash duration, frequency, patterns)

  • Dark adaptation protocols to ensure complete regeneration before experiments

Experimental Environment:

  • Temperature control to mimic the natural habitat of Liza saliens

  • Buffer composition reflecting physiological ion concentrations

  • Appropriate membrane environment (nanodiscs, liposomes, or cellular expression)

Detection Systems:

  • Temporal resolution appropriate for the process being studied

  • Sensitivity to detect responses at low light intensities

  • Dynamic range to capture both small and large responses

Control Experiments:

  • Non-expressing or mock-transfected controls

  • Dark controls and light adaptation series

  • Comparison with well-characterized rhodopsins

  • Pharmacological controls to validate pathway components

Studies of rhodopsin photoresponses have demonstrated that the kinetics and amplitude of the response can vary significantly depending on light intensity, with bright flashes producing qualitatively different responses than dim flashes . Additionally, the level of photoreceptor degeneration can correlate with changes in photoresponse characteristics, such as acceleration and desensitization to dim flashes .

How can rhodopsin deactivation kinetics be accurately measured and analyzed?

Accurate measurement and analysis of rhodopsin deactivation kinetics are essential for understanding the complete photoresponse cycle:

Experimental Approaches:

  • Suction pipette recordings from rod outer segments provide direct measurements of the photoresponse recovery phase

  • Fluorescence-based assays monitoring the release of activated G-protein

  • Biochemical assays measuring the rate of rhodopsin phosphorylation

  • Single-photon response analysis to isolate deactivation of individual rhodopsin molecules

Key Parameters to Measure:

  • Time constant of recovery phase (τrec)

  • Time to peak response

  • Integration time (area under the curve normalized to peak amplitude)

  • Dominant time constant of the falling phase

Analysis Framework:

  • Fit recovery phase with exponential functions to extract rate constants

  • Apply Pepperberg analysis to determine R* lifetime

  • Implement mathematical models incorporating multiple deactivation steps

  • Compare parameters across different conditions (calcium levels, mutations)

Research has shown that proteins like recoverin can significantly affect deactivation kinetics, particularly for bright flash responses, by inhibiting rhodopsin phosphorylation in a calcium-dependent manner . Studies with transgenic animals have demonstrated that mutations in rhodopsin can interfere with the inactivation of R*, altering the photoresponse recovery .

What methods are most effective for studying energy metabolism in photoreceptors expressing Recombinant Liza saliens Rhodopsin?

Recent research has identified energy metabolism dysfunction as a critical factor in rhodopsin-related cellular processes, requiring specialized methodological approaches:

Metabolic Measurement Techniques:

  • Seahorse XF Analyzer to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

  • Metabolic flux analysis using isotope-labeled substrates

  • ATP bioluminescence assays to quantify cellular ATP levels

  • NAD+/NADH and NADP+/NADPH ratio measurements to assess redox state

Mitochondrial Function Assessment:

  • Membrane potential measurements using fluorescent indicators

  • Calcium imaging to monitor mitochondrial calcium handling

  • Mitochondrial morphology analysis through fluorescence microscopy

  • Reactive oxygen species (ROS) detection

Experimental Design Considerations:

  • Comparison between wild-type and mutant rhodopsins

  • Time-course studies to track metabolic changes

  • Light exposure protocols to assess photoreceptor-specific energy demands

  • Pharmacological manipulation of specific metabolic pathways

Research with rhodopsin mutants has demonstrated that rhodopsin overexpression or mutation can lead to energy metabolism dysfunction, potentially contributing to photoreceptor degeneration . This dysfunction can manifest differently across various rhodopsin mutants, affecting oxidative phosphorylation and aerobic glycolysis to different degrees .

What approaches can be used to study the interaction between Liza saliens Rhodopsin and G-proteins?

Studying rhodopsin-G protein interactions requires specialized biochemical and biophysical approaches:

In Vitro Biochemical Methods:

  • GTPγS binding assays to measure the rate and extent of G-protein activation

  • Surface plasmon resonance (SPR) to determine binding kinetics and affinity

  • Pull-down assays with purified components to identify interaction domains

  • Cross-linking studies to capture transient interaction states

Cellular and Functional Approaches:

  • BRET/FRET assays to monitor protein-protein interactions in real-time

  • Electrophysiological recordings to assess functional coupling in native systems

  • Fluorescence complementation techniques to visualize interactions in situ

  • Mutagenesis studies targeting the intracellular loops of rhodopsin

Structural Methodologies:

  • Cryo-electron microscopy to capture the rhodopsin-G protein complex

  • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Computational modeling and molecular dynamics simulations

Research has identified specific regions in rhodopsin that are critical for G-protein interaction, including intracellular loops i2, i3, and i4, with glutamic acid 135 and arginine 136 at the cytoplasmic end of helix III being particularly important for transducin binding . Understanding these interactions is essential for interpreting how rhodopsin activates the phototransduction cascade.

How can comparative analyses between wild-type and mutant variants of Liza saliens Rhodopsin be optimized?

Optimizing comparative analyses between wild-type and mutant Liza saliens Rhodopsin variants requires a systematic approach:

Experimental Design Principles:

  • Matched expression systems and conditions

  • Simultaneous preparation and testing when possible

  • Blinded analysis to prevent bias

  • Sufficient biological and technical replicates for statistical power

  • Inclusion of appropriate controls

Multi-level Characterization Framework:

  • Structural integrity assessment (circular dichroism, thermal stability)

  • Spectral properties (absorption maxima, extinction coefficients)

  • Functional parameters (photobleaching rates, G-protein activation)

  • Cellular localization and trafficking in expression systems

  • Energy metabolism impacts as a downstream consequence

Data Analysis Methods:

  • Statistical testing appropriate for the data type

  • Effect size calculations beyond p-value significance

  • Multivariate analysis for complex phenotypes

  • Hierarchical clustering to identify mutation classes

  • Structure-function correlation analyses

Research has demonstrated that different classes of rhodopsin mutations can have distinct impacts on photoresponse characteristics and cellular physiology . For example, mutations in different regions may affect either rhodopsin activation, deactivation kinetics, or energy metabolism, requiring comprehensive analysis to fully characterize the phenotypic consequences .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.