Recombinant Lobularia maritima Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Lobularia maritima (Sweet alyssum) (Alyssum maritimum)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIN KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
A component of the cytochrome b6-f complex, mediating electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f and what is its role in Lobularia maritima?

Apocytochrome f is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain of Lobularia maritima (Sweet alyssum). This protein, encoded by the petA gene, functions as an electron carrier in the thylakoid membrane, facilitating electron transfer from photosystem II to photosystem I during photosynthesis . In Lobularia maritima, a flowering plant in the mustard family (Brassicaceae) native to the Mediterranean region, this protein maintains the characteristic structure found across photosynthetic organisms while exhibiting species-specific sequence variations .

The recombinant form preserves the functional domains of the native protein, spanning amino acid positions 36-320 of the full-length sequence. The protein contains characteristic motifs including the heme-binding domain with the conserved CXXCH motif visible in the amino acid sequence (IVCANCHLASK) .

What structural features characterize the recombinant Lobularia maritima Apocytochrome f?

The recombinant Lobularia maritima Apocytochrome f exhibits several critical structural features that determine its functionality:

  • Heme-binding domain: Contains the conserved CXXCH motif (specifically CHLASK) at positions 53-57 of the recombinant protein sequence .

  • Electron transfer interfaces: The protein contains multiple charged and aromatic residues that facilitate electron transfer, particularly in the IPYDMQLKQVLANGK region .

  • Membrane anchor region: The C-terminal hydrophobic segment (FLGSVVLAQIFLVLKK) serves as the transmembrane anchor in the native protein .

  • Iron-sulfur interaction sites: Multiple cysteine residues throughout the sequence create potential metal-binding sites essential for electron transport function .

The recombinant protein is expressed from the region encompassing amino acids 36-320 of the full sequence, which contains all functional domains except the transit peptide found in the native form .

What are the optimal conditions for expressing recombinant Lobularia maritima Apocytochrome f in heterologous systems?

Expression of recombinant Lobularia maritima Apocytochrome f requires careful optimization of expression systems and conditions. Based on research protocols:

Expression System Selection:

  • Prokaryotic systems (E. coli): Most commonly used for cytochrome proteins due to simplicity and yield, but proper folding may require specialized strains (SHuffle, Origami) that facilitate disulfide bond formation.

  • Eukaryotic systems: Recommended for full post-translational modifications, with insect cell lines (Sf9, High Five) showing superior results for membrane-associated proteins like Apocytochrome f.

Expression Optimization Parameters:

  • Temperature: 16-18°C for E. coli systems to reduce inclusion body formation

  • Induction: Low IPTG concentration (0.1-0.3 mM) for prokaryotic systems

  • Media supplementation: Addition of δ-aminolevulinic acid (0.5 mM) and iron salts (0.1 mM FeCl₃) to enhance heme incorporation

  • Expression time: Extended expression (72-96 hours) at lower temperatures yields better folded protein

The expression region (amino acids 36-320) excludes the transit peptide that would target the native protein to the chloroplast, improving heterologous expression efficiency . Codon optimization for the selected expression system significantly improves yields, particularly when expressing plant proteins in bacterial systems.

What purification strategies are most effective for obtaining high-purity recombinant Lobularia maritima Apocytochrome f?

Purification of recombinant Lobularia maritima Apocytochrome f requires a multi-step approach to achieve high purity while maintaining structural integrity:

Recommended Purification Protocol:

  • Initial Extraction:

    • For membrane-associated expression: Solubilization using mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

    • For inclusion bodies: Solubilization with 8M urea followed by step-wise refolding

  • Chromatography Strategy:

    • Primary capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA for His-tagged constructs

    • Intermediate purification: Ion exchange chromatography (typically anion exchange at pH 8.0)

    • Polishing: Size exclusion chromatography using Superdex 75 or 200 columns

  • Buffer Considerations:

    • Maintain 50 mM Tris-HCl pH 7.5-8.0, 150-300 mM NaCl throughout purification

    • Include 10% glycerol to stabilize protein structure

    • Consider adding low concentrations of reducing agents (0.5-1 mM DTT) to prevent oxidation

The purified protein can be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage . It's critical to avoid repeated freeze-thaw cycles, and working aliquots should be maintained at 4°C for no more than one week .

How can researchers verify the functional integrity of purified recombinant Lobularia maritima Apocytochrome f?

Verifying the functional integrity of purified recombinant Lobularia maritima Apocytochrome f involves multiple analytical techniques:

Spectroscopic Analysis:

  • UV-visible spectroscopy: Properly folded cytochrome f exhibits characteristic absorbance peaks at approximately 420 nm (Soret band) and 520-550 nm (α/β bands)

  • Circular dichroism: Should confirm expected secondary structure content (predominantly α-helical)

Functional Assays:

  • Electron transfer capacity: Measure using artificial electron donors/acceptors such as reduced cytochrome c and ferricyanide

  • Redox potential determination: Using spectroelectrochemical methods to verify the expected mid-point potential (+300 to +350 mV)

Structural Verification:

  • Limited proteolysis to confirm proper folding (correctly folded protein shows resistance to digestion at key domains)

  • Thermal shift assays to determine stability (Tm typically between 50-60°C for properly folded cytochrome proteins)

Activity Reconstitution:

  • In vitro reconstruction of partial electron transport chains using purified photosystem I components

  • Measurements of electron transfer rates compared to native protein benchmarks

These analyses should be performed immediately after purification and after various storage periods to assess stability under the recommended storage conditions (Tris-based buffer with 50% glycerol at -20°C) .

How can recombinant Lobularia maritima Apocytochrome f be incorporated into artificial membrane systems for functional studies?

Incorporation of recombinant Lobularia maritima Apocytochrome f into artificial membrane systems involves several methodological approaches:

Liposome Reconstitution:

  • Preparation of lipid mixtures mimicking thylakoid composition (MGDG:DGDG:SQDG:PG at 50:25:12.5:12.5 ratio)

  • Detergent-mediated reconstitution using:

    • Detergent dialysis method: Gradual removal of detergent (typically DDM) via dialysis

    • Direct incorporation: Addition of detergent-solubilized protein to preformed liposomes

    • Bio-beads adsorption: Controlled removal of detergent using hydrophobic beads

Proteoliposome Characterization:

  • Dynamic light scattering to verify size distribution (typically 100-200 nm)

  • Freeze-fracture electron microscopy to confirm protein incorporation

  • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility

Functional Assessment in Artificial Systems:

  • Flash photolysis with appropriate electron donors/acceptors

  • Proton gradient formation measured using pH-sensitive fluorescent dyes

  • Potentiometric measurements using membrane-impermeable voltage-sensitive dyes

The incorporation efficiency should be verified through protein:lipid ratio determination, with optimal results typically achieved at 1:200 to 1:500 molar ratios. These systems allow isolation of specific electron transport parameters without interference from other photosynthetic complexes.

What are the best approaches for studying protein-protein interactions involving Lobularia maritima Apocytochrome f?

Investigating protein-protein interactions of Lobularia maritima Apocytochrome f requires specialized techniques sensitive to transient interaction networks:

In Vitro Interaction Studies:

TechniqueAdvantagesLimitationsRecommended Parameters
Surface Plasmon ResonanceReal-time kinetics, label-freeRequires immobilizationFlow rate: 10-30 μL/min, Protein conc.: 10-500 nM
Isothermal Titration CalorimetryProvides thermodynamic parametersHigh protein consumptionProtein conc.: 20-50 μM, 25 injections
Microscale ThermophoresisLow sample consumption, solution-basedRequires fluorescent labeling5-16 dilution series, 40-80% LED power
Co-immunoprecipitationDetects native complexesAntibody availabilityUse of magnetic beads, mild detergents (0.1% DDM)

Crosslinking Mass Spectrometry Approach:

  • Chemical crosslinking using BS3 or EDC/NHS (1-5 mM, 30 min, 25°C)

  • Enzymatic digestion (typically trypsin, 1:50 ratio, 16h, 37°C)

  • LC-MS/MS analysis with dedicated crosslink identification software

  • Validation of interaction sites through mutagenesis studies

Computational Predictions:

  • Molecular docking using the known structures of interaction partners

  • Identification of conservation patterns at potential interaction interfaces

  • Electrostatic surface mapping to identify complementary regions

When studying interactions with plastocyanin or ferredoxin, consider using their recombinant versions from the same or closely related species to maintain native interaction characteristics.

What methodological approaches can be used to investigate the redox properties of recombinant Lobularia maritima Apocytochrome f?

Investigation of redox properties of recombinant Lobularia maritima Apocytochrome f requires specialized electrochemical and spectroscopic techniques:

Electrochemical Methods:

  • Cyclic voltammetry using modified electrodes (gold electrodes with self-assembled monolayers)

  • Differential pulse voltammetry for higher sensitivity measurements

  • Protein film voltammetry for direct electron transfer studies

Spectroelectrochemical Approaches:

  • Thin-layer cell setup with transparent electrodes (ITO or gold mesh)

  • Potential control while monitoring spectral changes

  • Determination of redox potential through Nernst plot analysis

  • Use of mediators (typically methyl viologen, benzyl viologen, anthraquinones) to facilitate electron transfer

EPR Spectroscopy:

  • X-band EPR to characterize the heme environment

  • Temperature-dependent measurements (4-100K) to determine relaxation properties

  • Pulsed EPR for more detailed electronic structure analysis

Stopped-Flow Kinetics:

  • Rapid mixing with reductants (sodium dithionite, reduced methyl viologen)

  • Monitoring the heme reduction rate at characteristic wavelengths

  • Analysis of electron transfer rates under various conditions

Typical experimental parameters include temperature range of 10-25°C, pH range of 6.0-8.0, and ionic strength of 50-200 mM to mimic physiological conditions. These methods provide insights into both thermodynamic (redox potential) and kinetic (electron transfer rates) parameters critical for understanding the protein's role in photosynthetic electron transport.

How can recombinant Lobularia maritima Apocytochrome f be used to study photosynthetic electron transport mechanisms?

Recombinant Lobularia maritima Apocytochrome f serves as a valuable tool for dissecting photosynthetic electron transport mechanisms through several research applications:

Reconstitution Studies:

Comparative Analysis:

  • Comparison with apocytochrome f from model organisms (spinach, tobacco, cyanobacteria)

  • Correlation of sequence variations with functional differences

  • Evolutionary insights into optimization of electron transport systems

Structure-Function Relationship Investigations:

  • Site-directed mutagenesis of key residues (particularly around the heme-binding site)

  • Effects of mutations on redox potential and electron transfer rates

  • Identification of determinants for interaction specificity with electron donors/acceptors

Inhibitor Studies:

  • Binding studies with known cytochrome b6f inhibitors (DBMIB, DNP-INT)

  • Competition assays to identify binding sites

  • Development of new inhibitors as research tools

These applications benefit from the well-characterized sequence of Lobularia maritima Apocytochrome f and allow researchers to connect structural features with functional properties in photosynthetic electron transport.

What insights can be gained by comparing recombinant Lobularia maritima Apocytochrome f with homologs from other plant species?

Comparative analysis of Lobularia maritima Apocytochrome f with homologs from other plant species provides valuable insights into evolutionary adaptation and functional optimization:

Evolutionary Conservation Analysis:

  • Identification of absolutely conserved residues critical for function

  • Variable regions that may relate to species-specific adaptations

  • Correlation of sequence conservation with structural elements

Functional Adaptation Studies:

  • Comparison of redox potentials between species from different environmental niches

  • Relationship between amino acid substitutions and electron transfer kinetics

  • Adaptations related to temperature tolerance and pH optima

Structural Comparison:

  • Homology modeling based on crystal structures from model organisms

  • Analysis of surface charge distribution differences

  • Identification of species-specific interaction interfaces

Photosynthetic Efficiency Correlation:

These comparative studies can leverage the full amino acid sequence information available for Lobularia maritima Apocytochrome f and similar data from other species to identify both fundamental conserved features and adaptive variations that might relate to the ecological niche of sweet alyssum as a Mediterranean coastal plant .

How can recombinant Lobularia maritima Apocytochrome f contribute to understanding stress adaptation in plants?

Recombinant Lobularia maritima Apocytochrome f provides a valuable model for investigating photosynthetic adaptation to environmental stresses:

Oxidative Stress Studies:

  • In vitro oxidative modification analysis using H₂O₂ and other ROS

  • Identification of particularly sensitive residues using mass spectrometry

  • Comparison of oxidative resistance between Lobularia and other species

Temperature Adaptation:

  • Thermal stability assessments across temperature ranges (5-45°C)

  • Effects of temperature on electron transfer kinetics

  • Correlation with Lobularia maritima's adaptation to Mediterranean climate

Salt Stress Response:

  • Structure-function changes under varying ionic strengths

  • Relevance to Lobularia maritima's coastal habitat adaptations

  • Comparison with glycophytic species' cytochrome f

Drought Adaptation Mechanisms:

  • Stability under dehydration conditions

  • Maintenance of function during water limitation

  • Correlation with Lobularia's adaptation to rocky, sunny coastal areas

Understanding these adaptations at the molecular level provides insights into Lobularia maritima's ability to thrive in coastal Mediterranean environments with high light intensity, periods of drought, and elevated salinity . This knowledge may contribute to broader understanding of photosynthetic adaptation to challenging environmental conditions.

What mass spectrometry methods are most suitable for characterizing recombinant Lobularia maritima Apocytochrome f?

Mass spectrometry analysis of recombinant Lobularia maritima Apocytochrome f requires specialized approaches to address the challenges posed by this heme-containing membrane protein:

Primary Structure Verification:

  • ESI-MS of intact protein for molecular weight confirmation

  • Top-down MS/MS for sequence verification without enzymatic digestion

  • Bottom-up approach with multiple proteases (trypsin, chymotrypsin, Glu-C) for comprehensive sequence coverage

Post-translational Modification Analysis:

  • Targeted analysis for heme attachment at the CXXCH motif

  • Phosphorylation site mapping using TiO₂ enrichment

  • Oxidative modifications using neutral loss scanning for methionine oxidation

Heme Environment Characterization:

  • Native MS to preserve non-covalent interactions

  • Ion mobility MS to assess conformational states

  • Hydrogen-deuterium exchange MS to probe solvent accessibility of the heme pocket

Structural Analysis:

  • Chemical crosslinking MS to map intramolecular distance constraints

  • Surface labeling techniques (hydroxyl radical footprinting) to assess solvent exposure

  • Limited proteolysis coupled with MS to identify flexible and rigid regions

These MS approaches should be optimized for membrane proteins, potentially incorporating detergent-compatible ionization methods or membrane-mimetic systems during sample preparation to maintain native-like structure.

How can crystallographic or cryo-EM approaches be optimized for structural studies of Lobularia maritima Apocytochrome f?

Structural determination of Lobularia maritima Apocytochrome f presents specific challenges that require optimization strategies:

X-ray Crystallography Approach:

  • Construct Optimization:

    • Removal of flexible termini (consider constructs spanning amino acids 45-280)

    • Fusion partners to enhance solubility (e.g., MBP, SUMO)

    • Surface entropy reduction mutations at high-entropy patches

  • Crystallization Strategies:

    • Detergent screening (DDM, LDAO, C12E8, LMNG)

    • Lipidic cubic phase for membrane-embedded structure

    • Antibody fragment co-crystallization to increase polar surfaces

  • Data Collection Considerations:

    • Synchrotron radiation with helical data collection to minimize radiation damage

    • Multiple wavelength approaches to leverage the iron in heme for phasing

Cryo-EM Optimization:

  • Sample Preparation:

    • Reconstitution into nanodiscs (MSP1D1 with POPC/POPG lipids)

    • Detergent-solubilized protein in amphipols (A8-35)

    • GraFix method to improve particle orientation distribution

  • Imaging Parameters:

    • Use of Volta phase plate to enhance contrast

    • Energy-filtered imaging to improve signal-to-noise ratio

    • Particle picking strategies optimized for membrane proteins

  • Data Processing:

    • 3D classification to separate conformational states

    • Focused refinement on the soluble domain

    • Lipid density restoration approaches

Both approaches benefit from complementary biophysical characterization (CD spectroscopy, thermal shift assays) to confirm that the protein maintains its native fold during sample preparation.

What computational methods can predict the functional properties of Lobularia maritima Apocytochrome f based on its sequence?

Advanced computational methods provide valuable insights into the functional properties of Lobularia maritima Apocytochrome f:

Homology Modeling and Structure Prediction:

  • AlphaFold2/RoseTTAFold for accurate structure prediction based on the provided sequence

  • Refinement of models with particular attention to the heme-binding pocket

  • Integration of experimental constraints where available

Molecular Dynamics Simulations:

  • All-atom simulations in explicit membrane environments

  • Analysis of conformational flexibility in different redox states

  • Identification of water channels and proton transfer pathways

Quantum Mechanics/Molecular Mechanics (QM/MM):

  • Electronic structure calculations of the heme environment

  • Prediction of redox potentials based on local electrostatics

  • Electron transfer pathway identification using Pathways algorithm

Network Analysis and Allosteric Communication:

  • Identification of residue interaction networks

  • Prediction of allosteric pathways between functional sites

  • Correlation with evolutionary conservation patterns

Machine Learning Approaches:

  • Prediction of interaction partners based on surface properties

  • Functional classification based on sequence motifs

  • Identification of critical residues for function through deep learning models

These computational approaches leverage the complete amino acid sequence information available for Lobularia maritima Apocytochrome f and can guide experimental design by identifying key residues for mutagenesis studies and predicting functional properties before experimental validation.

How does Lobularia maritima's Apocytochrome f contribute to its ecological role as a companion plant?

Lobularia maritima's ecological significance as a companion plant may be partially attributable to unique properties of its photosynthetic proteins, including Apocytochrome f:

Ecological Adaptation Mechanisms:

  • Potential role of efficient electron transport in supporting continuous flowering, which attracts beneficial insects

  • Adaptation to high light Mediterranean environments through optimized photosynthetic efficiency

  • Possible contribution to the plant's ability to thrive in diverse companion planting scenarios

Beneficial Insect Attraction:

  • Sweet alyssum attracts aphidophagous insects (Syrphidae, Coccinellidae) that help control pests in agricultural settings

  • Continuous bloom supported by efficient photosynthesis provides consistent nectar resources for beneficial insects

  • Field studies show significantly reduced aphid populations when Lobularia maritima is used as a companion plant with broad beans

Crop Yield Enhancement:

  • Research demonstrates increased pod and seed weight in broad beans when grown with sweet alyssum at various row spacings

  • The plant's capacity to maintain photosynthetic efficiency while growing as ground cover may contribute to its compatibility as a companion plant

Understanding the molecular adaptations in photosynthetic proteins like Apocytochrome f provides insight into how Lobularia maritima maintains its ecological functions across diverse environmental conditions, potentially informing better companion planting strategies.

How can structural insights from Lobularia maritima Apocytochrome f inform protein engineering for enhanced photosynthesis?

Structural and functional insights from Lobularia maritima Apocytochrome f can guide protein engineering efforts aimed at enhancing photosynthetic efficiency:

Engineering Targets:

  • Redox potential modulation through targeted mutations around the heme environment

  • Optimization of interaction interfaces with electron transfer partners

  • Enhancement of stability under stress conditions

  • Improvement of electron transfer kinetics

Rational Design Approaches:

  • Identification of rate-limiting steps in electron transfer

  • Computational prediction of mutations that could reduce these limitations

  • Structure-guided alterations of key residues to optimize energy landscapes

  • Integration of successful adaptations from various species into chimeric proteins

Directed Evolution Strategies:

  • Development of selection systems based on photosynthetic growth

  • High-throughput screening methods utilizing fluorescent reporters of electron transfer

  • Combination of rational design with directed evolution for iterative optimization

Potential Applications:

  • Enhancement of crop photosynthetic efficiency under suboptimal conditions

  • Development of bio-inspired electron transfer systems for artificial photosynthesis

  • Creation of more robust photosynthetic organisms for biofuel production

These approaches leverage the detailed sequence information available for Lobularia maritima Apocytochrome f and combine it with ecological observations about the plant's adaptability to create engineered proteins with enhanced functions.

What research approaches can connect molecular properties of Apocytochrome f to Lobularia maritima's effectiveness in integrated pest management?

Investigating the connection between molecular properties of Apocytochrome f and Lobularia maritima's role in integrated pest management requires multidisciplinary approaches:

Molecular-Ecological Connection Studies:

  • Analysis of photosynthetic efficiency under varying field conditions and its correlation with nectar production

  • Comparison of protein properties across Lobularia varieties with different attractiveness to beneficial insects

  • Investigation of how electron transport chain efficiency influences the production of volatile organic compounds that attract beneficial insects

Field-Laboratory Integration:

  • Correlation of field observations of aphid predator effectiveness with laboratory measurements of photosynthetic efficiency

  • Assessment of how different row spacings (50cm, 65cm, 80cm) affect both plant physiology and beneficial insect populations

  • Analysis of relationship between Lobularia's growth parameters and photosynthetic protein adaptations

Experimental Approaches:

  • Controlled environment studies comparing wild-type and modified Lobularia with altered cytochrome properties

  • Mass spectrometry analysis of nectar composition as it relates to photosynthetic efficiency

  • Transcriptomic and proteomic profiling under various companion planting configurations

Research shows that Lobularia maritima significantly enhances populations of aphidophagous insects (Syrphidae and Coccinellidae) and reduces black bean aphid (Aphis fabae) infestations when used as a companion plant with broad bean crops . Understanding the molecular basis of these ecological interactions could lead to optimized companion planting strategies and potentially guide the development of enhanced varieties for integrated pest management.

What are the major challenges in studying membrane-associated proteins like Lobularia maritima Apocytochrome f?

Research on membrane-associated proteins like Lobularia maritima Apocytochrome f presents several significant challenges:

Expression and Purification Challenges:

  • Obtaining sufficient quantities of properly folded protein with correct heme incorporation

  • Balancing detergent concentrations to solubilize the protein while maintaining native structure

  • Preventing aggregation during concentration and storage

  • Achieving homogeneous preparations suitable for structural studies

Structural Determination Limitations:

  • Difficulties in growing well-diffracting crystals of membrane proteins

  • Challenges in achieving high-resolution cryo-EM reconstructions due to small size

  • Accurately modeling the protein-membrane interface

  • Capturing physiologically relevant conformational states

Functional Characterization Obstacles:

  • Reconstituting proper orientation in artificial membrane systems

  • Measuring electron transfer in isolated systems versus in vivo conditions

  • Distinguishing direct effects of mutations from structural perturbations

  • Correlating in vitro measurements with physiological significance

Future Methodological Advances:

  • Development of improved membrane mimetics (novel nanodiscs, amphipols)

  • Application of advanced MS techniques for membrane protein analysis

  • Integration of computational predictions with sparse experimental data

  • Single-molecule approaches to capture conformational dynamics

Addressing these challenges requires integrated approaches combining complementary techniques and careful optimization of experimental conditions specific to the properties of Apocytochrome f.

What emerging technologies might advance research on Lobularia maritima Apocytochrome f in the next decade?

Several emerging technologies hold promise for advancing research on Lobularia maritima Apocytochrome f in coming years:

Advanced Structural Methods:

  • Microcrystal electron diffraction (MicroED) for structure determination from sub-micron crystals

  • Time-resolved serial crystallography to capture electron transfer intermediates

  • Integrative structural biology combining cryo-EM, crosslinking MS, and computational modeling

  • Advanced EPR techniques (DEER, ENDOR) for detailed electronic structure analysis

Single-Molecule Approaches:

  • Single-molecule FRET to track conformational changes during electron transfer

  • Optical tweezers combined with fluorescence for force-spectroscopy studies

  • High-speed AFM to visualize membrane protein dynamics in native-like environments

  • Nanopore-based single-molecule electrical measurements

Synthetic Biology Tools:

  • Cell-free expression systems optimized for membrane proteins with cofactors

  • Genetic code expansion for site-specific incorporation of probes and crosslinkers

  • Engineered orthogonal translation systems for in vivo studies

  • CRISPR-based approaches for precise genomic editing in Lobularia maritima

Computational Advances:

  • Enhanced sampling methods for membrane protein simulations

  • AI-driven prediction of protein-protein interactions

  • Integration of quantum mechanical methods with classical MD for electron transfer modeling

  • Systems biology approaches connecting molecular properties to physiological outcomes

These technologies promise to bridge current knowledge gaps and provide unprecedented insights into the structure-function relationships of this important photosynthetic protein.

How might future research on Lobularia maritima Apocytochrome f contribute to sustainable agriculture practices?

Future research on Lobularia maritima Apocytochrome f has significant potential to contribute to sustainable agriculture through several avenues:

Enhanced Companion Planting Strategies:

  • Molecular understanding of how Lobularia's photosynthetic efficiency contributes to its success as a companion plant

  • Development of optimized Lobularia varieties with improved beneficial insect attraction

  • Science-based recommendations for optimal row spacing and planting configurations based on molecular and ecological insights

Bioengineering Applications:

  • Transfer of beneficial adaptations from Lobularia's photosynthetic machinery to crop species

  • Development of stress-resistant variants based on understanding Lobularia's molecular adaptations

  • Creation of improved cover crop varieties with enhanced ecological functions

Integrated Pest Management Advancement:

  • Better understanding of the molecular basis for Lobularia's effectiveness in reducing aphid populations

  • Identification of key volatile compounds related to photosynthetic efficiency that attract beneficial insects

  • Development of precision agriculture approaches integrating companion plants based on molecular mechanisms

Climate Adaptation Strategies:

  • Insights from Lobularia's adaptation to Mediterranean conditions informing crop resilience strategies

  • Understanding how photosynthetic efficiency is maintained under variable environmental conditions

  • Application of knowledge to develop climate-resilient agricultural systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.