Recombinant Lobularia maritima Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: If a specific tag type is required, please inform us; we will prioritize development accordingly.
Synonyms
cemA; ycf10; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-229
Protein Length
full length protein
Species
Lobularia maritima (Sweet alyssum) (Alyssum maritimum)
Target Names
cemA
Target Protein Sequence
MAKKKALVPFFYLTSIVFLPWLISLCCNKSLKTWITNWWNTRQCETFLNDIQEKSVLEKF IQLEELFQLDEMIKEYPETDLHQFRLGIHKETIQFIKIHNEYRIHTILHFSTNLISFVIL SGYSFLGKEKLFILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGYIYKD FGFAHYEQILSGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHAIND
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion and indirectly promotes efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

What is Lobularia maritima cemA protein and what is its function?

The chloroplast envelope membrane protein (cemA) is a protein encoded by the chloroplast genome in Lobularia maritima. This protein is believed to play a role in CO₂ uptake and carbon concentration mechanisms within the chloroplast. The cemA gene is highly conserved across many plant species, suggesting its fundamental importance in photosynthetic processes. While specific characterization of cemA in L. maritima is still developing, research in other species indicates its involvement in maintaining proton balance across the chloroplast envelope membrane, which is crucial for efficient photosynthesis .

What expression systems are suitable for producing recombinant L. maritima cemA?

  • Microalgal platforms such as Chlamydomonas reinhardtii, which offer advantages in safety, metabolic diversity, scalability, and sustainability for recombinant protein production .

  • Plant-based expression systems that may provide appropriate post-translational modifications.

  • Yeast systems like Pichia pastoris for eukaryotic membrane protein expression.

The choice depends on research goals - bacterial systems offer high yield but may compromise protein folding, while eukaryotic systems may provide better folding but with lower yields .

What are the basic cultivation parameters for optimizing recombinant cemA expression?

When expressing recombinant proteins like cemA, several key parameters must be optimized:

  • Induction conditions: Timing of induction is critical, with evidence showing that induction times between 4-6 hours often yield optimal productivity levels for many recombinant proteins .

  • Temperature: Lower temperatures (15-25°C) often reduce inclusion body formation for membrane proteins.

  • Media composition: Specialized media formulations can improve yield and solubility.

  • Inducer concentration: The concentration of inducers like IPTG significantly impacts expression levels.

A multivariant approach to optimization is strongly recommended over the traditional univariant method, as it allows for simultaneous evaluation of multiple parameters and their interactions, leading to more efficient protocol development with fewer experiments .

Why is L. maritima an interesting source for recombinant protein research?

Lobularia maritima presents unique characteristics that make it valuable for molecular research:

  • It is a Mediterranean basin endemic plant with unusual flowering patterns that extend for 10 months, suggesting distinctive metabolic adaptations .

  • The species contains various bioactive compounds including flavonoids such as kaempferol derivatives and glucosinolates that demonstrate antioxidant and anti-inflammatory properties .

  • Its ability to thrive in coastal environments suggests adaptive cellular mechanisms that may confer unique properties to its proteins.

  • L. maritima has attracted research interest for its potential pharmaceutical applications, as evidenced by studies on its methanolic extract showing significant inhibitory activity against inflammatory mediators .

What strategies can overcome the challenges of expressing membrane proteins like cemA in soluble form?

Expressing membrane proteins like cemA in soluble form requires sophisticated approaches:

  • Glycomodule fusion: Research with other recombinant proteins has shown that C-terminal fusion with synthetic glycomodules comprised of tandem serine (Ser) and proline (Pro) repeats [(SP)ₙ, where n = 10 or 20] can increase secretion yields by up to 12-fold . This approach may be adapted for cemA expression.

  • Signal sequence optimization: The gametolysin signal sequence has demonstrated effectiveness in assisting protein secretion in microalgal systems . Evaluating various signal sequences specifically for cemA could significantly improve yields.

  • Statistical experimental design: Implementing a factorial design approach allows for systematic evaluation of multiple variables affecting protein expression. This methodology has been shown to achieve high levels (250 mg/L) of soluble functional recombinant protein expression in E. coli .

  • Detergent screening: Systematic evaluation of detergents for membrane protein solubilization is essential, with a recommended progression from mild (digitonin, DDM) to stronger (LDAO, OG) detergents.

How can researchers assess the functional integrity of recombinant cemA?

Assessing functional integrity of recombinant cemA requires multiple approaches:

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to verify secondary structure integrity

    • Thermal stability assays to determine protein stability

    • Size exclusion chromatography to confirm proper oligomeric state

  • Functional assays:

    • Reconstitution into liposomes to assess membrane integration

    • Proton flux measurements to verify functionality in maintaining pH gradients

    • CO₂ uptake assays in reconstituted systems

  • Structural validation:

    • Limited proteolysis to confirm proper folding

    • Epitope accessibility studies using conformation-specific antibodies

The complementary use of these approaches provides comprehensive validation of protein functionality before proceeding to more complex experiments.

What experimental design approaches are most effective for optimizing cemA expression parameters?

Factorial design approaches offer significant advantages over traditional one-variable-at-a-time methods for optimizing recombinant protein expression:

  • Fractional factorial screening design: This approach allows evaluation of 8 variables related to medium composition and induction conditions on critical responses (cell growth, biological activity, and productivity) with a reduced number of experiments .

  • Statistical optimization: The table below illustrates a typical experimental design matrix for evaluating multiple variables affecting cemA expression:

ExperimentTemperature (°C)Inducer Concentration (mM)Media CompositionInduction Time (h)Expression Level (mg/L)
1150.1LB4N/A*
2150.5TB6N/A*
3250.1TB6N/A*
4250.5LB4N/A*

*Note: Actual expression levels would be determined experimentally.

  • Response surface methodology (RSM): After identifying significant variables through factorial design, RSM allows for fine-tuning optimal conditions by exploring the relationship between variables and responses through three-dimensional surface plots .

  • Orthogonality maintenance: When using fractional designs, maintaining statistical orthogonality is crucial for estimating independent parameters accurately .

How can post-translational modifications of recombinant cemA be characterized and optimized?

Characterization and optimization of post-translational modifications (PTMs) for cemA requires:

  • Glycosylation analysis:

    • Specific staining techniques (PAS, Coomassie) to detect glycosylation

    • Mass spectrometry to identify specific glycosylation patterns

    • Enzymatic deglycosylation to determine functional impact

  • PTM site mapping:

    • Proteomic analysis with high-resolution mass spectrometry

    • Site-directed mutagenesis of predicted modification sites

    • PTM-specific antibodies for immunoblotting

  • Subcellular localization studies:

    • Treatment with inhibitors like brefeldin A to understand PTM processing pathways

    • Immunofluorescence microscopy to track protein trafficking

    • Fractionation studies to confirm membrane integration

Research with other recombinant proteins suggests that glycosylation of fusion proteins with (SP)ₙ glycomodules initiates in the endoplasmic reticulum, which could be relevant for cemA expression systems .

What purification strategies are recommended for recombinant cemA?

Purification of membrane proteins like cemA requires specialized approaches:

  • Detergent-based extraction:

    • Initial solubilization using mild detergents (DDM, LMNG)

    • Careful optimization of detergent concentration is critical

    • Consideration of lipid supplementation during extraction

  • Chromatographic purification:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged proteins

    • Size exclusion chromatography for oligomeric state determination

    • Ion exchange chromatography for further purification

  • Validation of homogeneity:

    • SDS-PAGE with multiple staining techniques

    • Western blotting with specific antibodies

    • Dynamic light scattering to assess monodispersity

A systematic approach involving multiple chromatographic steps can achieve protein homogeneity levels of approximately 75%, as demonstrated with other recombinant proteins .

How can researchers develop reliable activity assays for cemA functional characterization?

Developing reliable activity assays for cemA involves:

  • Transport function assessment:

    • Reconstitution into proteoliposomes for proton transport assays

    • pH-sensitive fluorescent dyes to monitor proton flux

    • Radioactive isotope uptake studies for substrate transport

  • Binding partner identification:

    • Pull-down assays to identify interacting proteins

    • Surface plasmon resonance (SPR) for binding kinetics

    • Yeast two-hybrid or split-GFP assays for in vivo interaction

  • Structural integrity validation:

    • Thermal shift assays to monitor protein stability

    • Limited proteolysis to assess proper folding

    • Circular dichroism to confirm secondary structure elements

Standardization of assay conditions is crucial, with careful consideration of buffer composition, pH, temperature, and lipid environment to ensure reproducibility across experiments.

What are the critical considerations for experimental design when studying cemA-protein interactions?

When designing experiments to study cemA interactions with other proteins:

  • Control selection:

    • Positive controls should include known chloroplast membrane protein interactions

    • Negative controls should include non-interacting proteins with similar physicochemical properties

    • Technical replicates (minimum n=3) are essential for statistical validity

  • Environmental factors:

    • Lipid composition significantly affects membrane protein behavior

    • pH gradients may alter interaction dynamics

    • Ionic strength can disrupt or enhance protein-protein interactions

  • Detection methods:

    • Förster resonance energy transfer (FRET) for direct measurement of protein proximity

    • Co-immunoprecipitation with specific antibodies

    • Label-free techniques like isothermal titration calorimetry for binding energetics

  • Data analysis approaches:

    • Statistical methods appropriate for small sample sizes

    • Correction for multiple comparisons when screening multiple potential interactors

    • Quantitative analysis of binding stoichiometry

How can researchers address low solubility issues with recombinant cemA?

Low solubility is a common challenge with membrane proteins like cemA. Approaches to address this include:

  • Fusion partner strategies:

    • MBP (maltose-binding protein) fusion can significantly enhance solubility

    • SUMO fusion may improve folding and solubility

    • Glycomodules like (SP)ₙ can enhance secretion and stability

  • Expression conditions modification:

    • Reducing expression temperature to 15-18°C

    • Using specialized E. coli strains designed for membrane proteins

    • Co-expression with molecular chaperones

  • Buffer optimization:

    • Screening detergent panels for optimal solubilization

    • Addition of glycerol (5-10%) to stabilize solubilized protein

    • Incorporation of specific lipids that may be required for stability

  • Refolding strategies:

    • Denaturation followed by controlled refolding in appropriate detergent/lipid mixtures

    • On-column refolding during affinity purification

    • Dialysis-based gradual detergent exchange methods

What approaches can resolve protein degradation issues during cemA production?

Protein degradation during recombinant cemA production can be addressed through:

  • Protease inhibition strategies:

    • Addition of protease inhibitor cocktails during extraction

    • Use of E. coli strains deficient in specific proteases

    • Optimization of cell lysis conditions to minimize proteolytic activation

  • Stability enhancement:

    • Incorporation of glycomodules like (SP)ₙ, which have been shown to enhance proteolytic stability of recombinant proteins

    • Addition of stabilizing agents like glycerol or specific lipids

    • Optimization of pH and ionic strength to enhance stability

  • Process optimization:

    • Minimizing handling time during purification

    • Maintaining cold temperature throughout processing

    • Using arginine or proline as stabilizing additives in buffers

  • Storage considerations:

    • Flash-freezing in liquid nitrogen with cryoprotectants

    • Testing stability in different buffer compositions

    • Evaluating lyophilization as a potential preservation method

How can researchers interpret contradictory results in cemA functional studies?

When faced with contradictory results in cemA functional studies:

  • Methodological validation:

    • Verify protein integrity through multiple biophysical techniques

    • Confirm activity using orthogonal assay methods

    • Validate antibody specificity with appropriate controls

  • Experimental variables analysis:

    • Systematically evaluate buffer components that may affect function

    • Consider the impact of different detergents on protein activity

    • Assess the influence of lipid composition on functional measurements

  • Data integration approaches:

    • Combine structural data with functional measurements

    • Use computational modeling to interpret contradictory findings

    • Apply statistical methods designed for reconciling divergent datasets

  • Biological context consideration:

    • Evaluate results in the context of L. maritima's natural environment

    • Consider potential species-specific adaptations that may affect protein function

    • Assess possible post-translational modifications unique to L. maritima

What mass spectrometry approaches are most effective for cemA characterization?

For comprehensive characterization of cemA using mass spectrometry:

  • Intact protein analysis:

    • Native MS for determining oligomeric states

    • Top-down proteomics for characterizing full-length protein and major fragments

    • Ion mobility MS for conformational assessment

  • Peptide-level analysis:

    • Bottom-up proteomics with multiple proteases for complete sequence coverage

    • Crosslinking MS to map protein-protein interactions

    • Hydrogen-deuterium exchange MS to probe structural dynamics

  • Post-translational modification mapping:

    • Electron transfer dissociation (ETD) for preserving labile modifications

    • Multiple reaction monitoring (MRM) for quantitative PTM analysis

    • Glycopeptide analysis using specialized fragmentation techniques

Similar approaches have been successfully used to characterize complex flavonoid compounds in L. maritima extracts, identifying specific kaempferol derivatives with high precision .

How can structural biology techniques be applied to cemA research?

Structural characterization of membrane proteins like cemA presents unique challenges that can be addressed through:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.