Recombinant Lobularia maritima NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

What is the basic structure and function of Lobularia maritima NAD(P)H-quinone oxidoreductase subunit 3?

The NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) from Lobularia maritima is a chloroplastic protein comprised of 120 amino acids. Its complete sequence is: MFLLYEYDIFWAFLIISSAIPVLAFLISGVLSPIRKGPEKLSSYESGIEPIGDAWLQFRIRYYMFALVFVVFDVETVFLYPWAMSFDVLGVSAFIEAFIFVLILILGLVYAWRKGALEWS . This protein functions as part of the NAD(P)H dehydrogenase complex in chloroplasts, catalyzing electron transfer reactions in the photosynthetic electron transport chain. The protein contains transmembrane domains that facilitate its integration into the thylakoid membrane, where it participates in cyclic electron flow around photosystem I and chlororespiration.

How should recombinant Lobularia maritima ndhC protein be stored and handled in laboratory settings?

For optimal stability and activity retention, recombinant Lobularia maritima ndhC protein should be stored at -20°C or -80°C for extended storage periods . The protein is typically supplied in a Tris-based buffer containing 50% glycerol . When working with the protein, it's recommended to:

• Briefly centrifuge the vial before opening to bring contents to the bottom

• Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% for long-term storage

• Prepare working aliquots to avoid repeated freeze-thaw cycles, which significantly reduce protein activity

• Store working aliquots at 4°C for no longer than one week

What expression systems are typically used for producing recombinant Lobularia maritima ndhC protein?

The recombinant Lobularia maritima ndhC protein is commonly expressed in E. coli expression systems . This heterologous expression system allows for high-yield production of the full-length protein (amino acids 1-120) with an N-terminal His-tag for purification purposes. The bacterial expression approach circumvents challenges associated with extracting the native protein from plant tissues, which would be limited by low abundance and difficult extraction procedures. When expressed in E. coli, the protein can be purified to >90% purity as determined by SDS-PAGE analysis .

What analytical techniques are recommended for characterizing the structural properties of recombinant Lobularia maritima ndhC protein?

For comprehensive structural characterization of recombinant Lobularia maritima ndhC protein, researchers should consider a multi-technique approach:

• X-ray crystallography: While no crystal structure of the Lobularia maritima ndhC has been reported, techniques similar to those used for human and mouse NAD(P)H:quinone oxidoreductases can be adapted (resolutions of 1.7-2.8 Å have been achieved for related proteins)

• Circular dichroism (CD) spectroscopy: For assessment of secondary structure elements and thermal stability

• Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS): To determine oligomeric state and homogeneity

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To probe solvent accessibility and conformational dynamics

• Cryo-electron microscopy: Particularly valuable for visualizing the protein in its native membrane environment or as part of larger protein complexes

The integration of these techniques can provide insights into the structural basis for the protein's function within the chloroplast electron transport chain.

How can researchers effectively assess the enzymatic activity of recombinant Lobularia maritima ndhC?

Assessing the enzymatic activity of recombinant Lobularia maritima ndhC requires specialized approaches due to its role in complex electron transfer processes. A methodological framework should include:

• Quinone reduction assay: Monitor the decrease in absorbance of NAD(P)H at 340 nm in the presence of quinone substrates like duroquinone or decylubiquinone, similar to approaches used with other NAD(P)H:quinone oxidoreductases

• Oxygen consumption measurements: Using a Clark-type electrode to measure rates of oxygen utilization in reconstituted systems

• Electron paramagnetic resonance (EPR) spectroscopy: To detect formation of semiquinone intermediates and characterize electron transfer mechanisms

• Reconstitution into liposomes: To evaluate activity in a membrane-like environment that better mimics the native chloroplastic conditions

• Coupled enzyme assays: Where the product of ndhC activity serves as substrate for a secondary reaction with easily detectable output

For accurate activity measurements, it's essential to consider the ping-pong mechanism characteristic of these enzymes, where NAD(P)H binding, flavin reduction, NAD(P)+ release, and subsequent quinone binding and reduction occur in sequence .

How does Lobularia maritima ndhC compare structurally and functionally to analogous proteins in other plant species?

Lobularia maritima ndhC belongs to the broader family of plastid-encoded NAD(P)H dehydrogenase (NDH) complex subunits. Comparative analysis reveals:

Researchers investigating these comparative aspects should employ multiple sequence alignment tools, homology modeling approaches, and cross-species functional complementation studies to elucidate evolutionary and functional relationships.

What is known about the role of post-translational modifications in regulating Lobularia maritima ndhC activity?

Post-translational modifications (PTMs) represent a critical but understudied aspect of ndhC regulation. Current understanding suggests:

• Phosphorylation sites: Several serine and threonine residues in the non-membrane domains are potential targets for kinase-mediated phosphorylation, potentially regulating protein-protein interactions within the NDH complex

• Redox-sensitive modifications: Cysteine residues may undergo oxidation-reduction reactions in response to changing chloroplast redox states, providing a mechanism for activity regulation

• Proteolytic processing: The mature protein may undergo N-terminal processing during chloroplast import and assembly into the NDH complex

• Lipid modifications: Potential lipidation may facilitate membrane association and complex assembly

Methodological approaches to study these PTMs should include mass spectrometry-based proteomics with enrichment strategies for specific modifications, site-directed mutagenesis of putative modification sites, and in vitro modification assays to determine functional consequences.

How can recombinant Lobularia maritima ndhC be utilized in photosynthesis research?

Recombinant Lobularia maritima ndhC presents numerous applications in photosynthesis research:

These applications contribute to fundamental understanding of photosynthetic electron transport and may inform strategies for improving crop productivity under changing environmental conditions.

What experimental approaches are recommended for investigating interactions between ndhC and other subunits of the NDH complex?

Investigating protein-protein interactions involving ndhC requires specialized techniques suitable for membrane proteins:

• Co-immunoprecipitation with subunit-specific antibodies: Using anti-His tag antibodies for the recombinant ndhC to pull down interaction partners

• Crosslinking mass spectrometry (XL-MS): To capture transient interactions and determine spatial proximity of subunits within the complex

• Fluorescence resonance energy transfer (FRET): For analyzing interactions in reconstituted membrane systems or in vivo

• Split-reporter protein complementation assays: To verify specific interactions in heterologous expression systems

• Surface plasmon resonance (SPR): For quantitative determination of binding kinetics between purified components

• Native gel electrophoresis: To preserve and analyze intact complexes and subcomplexes

These approaches should be combined with functional assays to correlate structural interactions with enzymatic activities and electron transfer efficiencies.

What strategies can be employed to study the redox properties of the FAD cofactor in ndhC?

The FAD cofactor plays a central role in the electron transfer function of NAD(P)H:quinone oxidoreductases. Specialized techniques for studying its redox properties include:

• Spectroelectrochemistry: To determine the reduction potentials of the FAD cofactor under varying conditions

• Stopped-flow spectroscopy: For kinetic analysis of electron transfer between NAD(P)H, FAD, and quinone substrates

• Resonance Raman spectroscopy: To probe the electronic structure of the flavin in different oxidation states

• Time-resolved fluorescence: To capture transient intermediates during the catalytic cycle

• Redox poising experiments: To establish the relationship between environmental redox potential and enzyme activity

How might the antioxidant properties of Lobularia maritima extracts relate to the function of ndhC?

Lobularia maritima extracts have demonstrated notable antioxidant activities, with significant DPPH radical scavenging potential observed in both methanolic extracts and ethyl acetate fractions . The relationship between these antioxidant properties and ndhC function may involve:

• Redox homeostasis: ndhC activity contributes to maintaining chloroplast redox balance, potentially complementing non-enzymatic antioxidants like flavonoids identified in L. maritima extracts (kaempferol derivatives)

• Stress response coordination: The NDH complex activity may be upregulated under oxidative stress conditions, working in concert with antioxidant metabolites

• Photoprotection: Both systems may contribute to protecting photosynthetic apparatus under excess light conditions

• Evolutionary adaptation: The plant may have co-evolved enzymatic (including ndhC) and non-enzymatic antioxidant systems as complementary protective mechanisms

Research exploring these connections could involve comparing wildtype and ndhC-deficient plants for antioxidant metabolite profiles, measuring oxidative stress markers, and assessing photosynthetic performance under stress conditions.