Recombinant Lobularia maritima Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Photosystem II and the Role of CP47 (psbB)

Photosystem II (PSII) is a membrane-bound complex in oxygenic phototrophs responsible for light-driven water oxidation and electron transfer. CP47 (encoded by psbB) is a core chlorophyll-binding apoprotein critical for:

  • Light Harvesting: Anchoring 16 chlorophylls and 3 β-carotenes to facilitate energy transfer to the reaction center (RC47) .

  • Structural Stability: Maintaining the integrity of the PSII core complex alongside CP43, D1, and D2 subunits .

  • Assembly Intermediates: Associating with auxiliary proteins (e.g., Psb28, Pam68) during PSII biogenesis .

Protein Architecture

FeatureDescriptionSource
Molecular Weight~55.9 kDa (full-length)
Chlorophyll Binding16 Chl a molecules, 3 β-carotenes; site-specific energy transfer
Membrane TopologySingle transmembrane helix; cytosolic N-terminus, luminal C-terminus
Key InteractionsPsbH, PsbT, PsbL; stabilizes RC47 during assembly

Sequence Comparison

Recombinant psbB from Lactuca sativa (Q332V1) and Populus deltoides (O03061) share >90% homology, with conserved domains for chlorophyll insertion and subunit binding . Lobularia maritima’s sequence would likely align with these, given Brassicaceae family relationships.

Expression Systems

ParameterLactuca sativa (Q332V1) Populus deltoides (O03061) Hypothetical L. maritima
HostE. coliE. coliE. coli (predicted)
TagN-terminal HisUndeterminedN-terminal His (standard)
Purity>90% (SDS-PAGE)>90% (SDS-PAGE)>90% (SDS-PAGE)
Storage BufferTris/PBS, 6% trehalose, pH 8.0Tris-based, 50% glycerolTris/PBS, 6% trehalose

Functional Validation

For Lactuca and Populus recombinant psbB:

  • Chlorophyll Incorporation: Confirmed via spectral analysis and native gel electrophoresis .

  • Assembly Role: Interacts with PsbH and Psb28 to stabilize RC47 during PSII maturation .

Biogenesis and Auxiliary Proteins

  • Psb28: Binds CP47 during assembly, preventing photodamage by blocking electron transfer to the acceptor side .

  • Pam68: Stabilizes nascent CP47 at the ribosome-SecY translocon interface, facilitating chlorophyll loading .

  • Psb34: Associates with CP47 and PsbH to mediate CP43 attachment in PSII assembly intermediates .

Gaps and Future Directions for Lobularia maritima psbB

  1. Lack of Direct Data: No studies explicitly report L. maritima psbB recombinant production or function.

  2. Potential Applications:

    • Photosynthetic Engineering: Modifying CP47 to enhance PSII efficiency in halophytes like L. maritima.

    • Antioxidant Research: Leveraging L. maritima’s known antioxidant properties to study redox interactions with psbB.

  3. Technical Challenges:

    • Low Expression Yield: Chlorophyll-binding proteins often require specialized refolding protocols .

    • Stability Issues: Isolated CP47 may undergo structural destabilization, as observed in cyanobacterial PSII .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs when placing your order. We will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it as requested.
Synonyms
psbB; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Lobularia maritima (Sweet alyssum) (Alyssum maritimum)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLSVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITNSWGGWNITGGTITNPGLWSYEGVAAAHIVFSGLCFLAAIWHWVYWDL EIFCDERTGKPSLDLPKIFGIHLFLSGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQP VNPAWGVEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSAGLAENQSVSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRNKEGRELFVRRMP TFFETFPVVLVDGDGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRAQLGEIFELDRATLKSDGVFRSSPRGWFTFGHASFALLFFFGHIWHGSRTLFRDVFA GIDPDLDAQVEFGAFQKLGDPTTKRQAV
Uniprot No.

Target Background

Function
Recombinant Lobularia maritima Photosystem II CP47 chlorophyll apoprotein (psbB) is a crucial component of the Photosystem II (PSII) core complex. It binds chlorophyll and plays a key role in catalyzing the primary light-induced photochemical reactions within PSII. PSII is a light-driven water:plastoquinone oxidoreductase that utilizes light energy to extract electrons from H(2)O, generating O(2) and a proton gradient. This proton gradient is subsequently used for ATP formation.
Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CP47 in Photosystem II?

CP47 functions as a core chlorophyll-binding antenna protein in Photosystem II (PSII), one of two types of photosynthetic reaction centers located in the thylakoid membranes of cyanobacteria, algae, and plants . As a chlorophyll apoprotein, CP47 binds multiple chlorophyll molecules that harvest light energy and transfer it to the reaction center. CP47 is structurally integrated into what researchers call the CP47 module (CP47mod), containing neighboring small transmembrane subunits including PsbH, PsbL, PsbM, and PsbT . The protein plays a critical role in both the structural integrity of PSII and in energy transfer efficiency during photosynthesis.

Beyond its primary light-harvesting function, CP47 contributes to PSII dimer formation and stabilization. In particular, CP47's interactions with small subunits like PsbM and PsbT help form the interface between PSII monomers within the dimer structure . This organization is essential for optimal photosynthetic performance.

What is the molecular structure and composition of the Lobularia maritima CP47 protein?

The Lobularia maritima (Sweet alyssum) CP47 protein consists of 508 amino acids in its full-length form . Its amino acid sequence begins with MGLPWYRVHT and continues through a series of hydrophobic and hydrophilic regions that create its characteristic transmembrane structure . The protein has several transmembrane helices connected by loops, with specific regions dedicated to chlorophyll binding.

The complete amino acid sequence of Lobularia maritima CP47 is documented under UniProt accession number A4QLM0 . The protein contains multiple transmembrane segments and chlorophyll-binding domains necessary for its function. Structurally, CP47 also contains binding sites for interaction with other PSII subunits and assembly factors.

How is chlorophyll incorporation regulated during CP47 biogenesis?

Chlorophyll incorporation into CP47 occurs co-translationally and is a prerequisite for correct protein folding . Unlike some other PSII components such as D1 and D2, which can be detected in chlorophyll-free conditions, CP47 assembly is strictly dependent on chlorophyll availability. This process must be tightly coordinated with chlorophyll biosynthesis to prevent accumulation of free chlorophyll, which is highly phototoxic .

Besides chlorophyll, β-carotene also plays a critical role in CP47 biogenesis. Studies have shown that the stability of CP47 is dramatically impaired in mutants lacking β-carotene . Unlike chlorophyll, carotenoids can safely accumulate as free molecules in the membrane. Current models suggest that β-carotene transfers spontaneously to CP47 from a membrane pool during chlorophyll incorporation, providing essential photoprotection .

What experimental approaches are used to study CP47 integration into PSII assembly intermediates?

Several complementary experimental approaches are employed to study CP47 integration into PSII assembly intermediates:

  • Isolation of assembly intermediates: Researchers often isolate assembly intermediates like RC47 (a complex lacking CP43) using sucrose gradient centrifugation or column chromatography followed by identification via immunoblotting or mass spectrometry .

  • Cryo-electron microscopy (cryo-EM): Recent advances in cryo-EM have enabled high-resolution structural characterization of assembly intermediates containing CP47, revealing specific interaction sites with assembly factors like Psb28, Psb34, and Hlip heterodimers .

  • Mutant analysis: Genetic mutants lacking specific assembly factors or PSII subunits have helped elucidate the stepwise process of CP47 integration and the factors required for stable complex formation .

  • Pulse-chase experiments: These are used to track the kinetics of CP47 incorporation into increasingly complete PSII assemblies, often using radiolabeled amino acids to follow protein synthesis and assembly .

RC47 is particularly important in these studies as it represents a heterogeneous mixture of complexes formed during both assembly and repair of PSII . While lacking CP43 and the manganese cluster required for oxygen evolution, RC47 retains limited electron transfer capability from tyrosine Yz to QA .

How do assembly factors influence CP47 incorporation into functional PSII?

Multiple assembly factors play critical roles in CP47 incorporation into functional PSII:

  • Psb28: This extrinsic subunit binds to CP47-containing intermediates including RC47 . Recent cryo-EM structures have revealed that Psb28 primarily interacts with D1, D2, and CP47, inducing substantial structural changes in the cytoplasmic regions of these proteins . These changes include distortion of the QB pocket and alterations in iron ligation that may protect PSII from photodamage by reducing singlet oxygen production . Interestingly, Psb28 appears to temporarily block assembly progression at the RC47 stage, possibly conferring special functions to this intermediate .

  • Hlip heterodimers (HliA/C and HliB/C): In Synechocystis, these heterodimers associate with CP47 during stress conditions and are detected in both RC47 and larger PSII core complexes . They likely provide photoprotection to CP47-containing assembly intermediates .

  • Psb34 and Psb35: Psb34 binds to the cytoplasmic side of CP47-containing intermediates and may promote detachment of Hlip heterodimers during later assembly stages . Psb35 helps stabilize the binding of Hlips to CP47 and increases complex stability in the dark .

  • Other factors: Additional proteins including CyanoP, Ycf48, and RubA have been detected in subpopulations of RC47, potentially representing PSII in various stages of assembly or repair .

What methods are used to produce and purify recombinant CP47 for structural studies?

Production and purification of recombinant CP47 for structural studies involves several sophisticated techniques:

  • Expression systems: Recombinant CP47 can be produced in heterologous expression systems, though this presents challenges due to the protein's complex membrane integration and cofactor requirements. Expression regions typically include the full 508 amino acid sequence .

  • Purification approaches: Following expression, CP47 is typically purified using affinity chromatography facilitated by fusion tags determined during the production process . The protein is maintained in specialized buffer conditions (often Tris-based buffer with 50% glycerol) optimized for stability .

  • Storage considerations: Purified CP47 is typically stored at -20°C or -80°C for extended storage, with working aliquots kept at 4°C for up to one week . Repeated freezing and thawing is not recommended due to potential protein degradation .

  • Quality assessment: Purified protein is typically assessed using SDS-PAGE, Western blotting, and spectroscopic methods to confirm integrity, purity, and proper folding before use in structural studies.

How does chlorophyll regulate CP47 stability at the molecular level?

Chlorophyll regulation of CP47 stability operates through several molecular mechanisms:

  • Co-translational incorporation: Chlorophyll molecules are inserted co-translationally into CP47, serving as a prerequisite for correct protein folding . This process differs from some other PSII subunits like D1 and D2, which appear less chlorophyll-dependent .

  • Post-translational stabilization: Research has demonstrated that light-induced chlorophyll biosynthesis triggers chlorophyll protein accumulation primarily by enhancing apoprotein stability rather than by affecting translation initiation or elongation . Studies in barley chloroplasts showed that chlorophyll-bound CP43 (a protein similar to CP47) exhibited significantly greater stability than the unbound apoprotein .

  • Cofactor integration: The integration of chlorophyll and β-carotene into CP47 creates a properly folded protein structure resistant to proteolytic degradation . Without these pigments, nascent CP47 likely adopts non-native conformations that are targeted for degradation by quality control mechanisms.

  • Protection from oxidative damage: Proper incorporation of chlorophyll and associated carotenoids protects CP47 from oxidative damage that would otherwise lead to protein destabilization and degradation. This protection is especially critical during high light conditions .

The molecular basis for this stabilization likely involves specific structural changes that occur when chlorophyll binds to CP47, shielding hydrophobic surfaces and creating a more compact, protease-resistant conformation.

What are the technical challenges in studying recombinant CP47-chlorophyll interactions?

Studying recombinant CP47-chlorophyll interactions presents several significant technical challenges:

How do CP47 mutations affect PSII assembly and photosynthetic efficiency?

CP47 mutations have profound effects on PSII assembly and photosynthetic efficiency through several mechanisms:

  • Chlorophyll binding disruption: Mutations in chlorophyll-binding residues impair pigment incorporation, leading to destabilized protein and compromised energy transfer. Since chlorophyll is required for proper CP47 folding, such mutations often result in complete absence of assembled CP47 in the thylakoid membrane .

  • Interface disruption: Mutations affecting the interfaces between CP47 and small subunits (PsbH, PsbL, PsbM, and PsbT) disrupt their association, compromising PSII dimer formation and stability . Particularly, alterations at interfaces with PsbM and PsbT, which form part of the connection between PSII monomers, can prevent dimerization .

  • Assembly factor interactions: Mutations that alter binding sites for assembly factors like Psb28, Hlips, Psb34, or Psb35 interfere with the regulated assembly process, potentially resulting in premature or incorrect complex formation . For example, disruption of Psb28 binding sites may eliminate important photoprotective mechanisms during assembly .

  • Electron transport effects: Mutations in regions of CP47 that influence the properties of nearby electron transport components can alter PSII function even if structural assembly appears normal. For instance, mutations near the interfaces with D1 and D2 can modify the properties of electron acceptors QA and QB, reducing photosynthetic efficiency .

What is the relationship between CP47 assembly and chlorophyll biosynthesis coordination?

The relationship between CP47 assembly and chlorophyll biosynthesis is characterized by tight coordination to prevent accumulation of phototoxic free chlorophyll molecules:

What analytical techniques are most effective for characterizing recombinant CP47 quality?

Several analytical techniques provide complementary information for comprehensive characterization of recombinant CP47 quality:

  • Absorption spectroscopy: Provides information on chlorophyll binding and protein folding by measuring characteristic absorption peaks of properly bound chlorophyll molecules. Well-folded CP47 exhibits distinct spectral features reflecting the specific microenvironments of bound pigments.

  • Circular dichroism (CD) spectroscopy: Assesses secondary structure content and can detect conformational changes in recombinant CP47 compared to the native protein. Both far-UV (peptide backbone) and visible-region (pigment-protein interactions) CD spectra provide valuable structural information.

  • Fluorescence spectroscopy: Reveals energy transfer efficiency within the protein. Time-resolved fluorescence can detect subtle changes in pigment organization that affect excitation energy transfer.

  • Size exclusion chromatography: Evaluates protein homogeneity and aggregation state, which are critical quality parameters for structural studies. Properly folded CP47 should elute as a well-defined peak corresponding to its expected molecular size.

  • Mass spectrometry: Confirms protein identity, integrity, and post-translational modifications. Native mass spectrometry can also verify chlorophyll binding stoichiometry in intact protein-pigment complexes.

  • Functional reconstitution assays: Assess the ability of recombinant CP47 to integrate into PSII assembly intermediates or participate in energy transfer, providing the most relevant measure of biological functionality.

How can researchers optimize expression systems for producing functional recombinant CP47?

Optimizing expression systems for functional recombinant CP47 requires addressing several key challenges:

  • Host selection: Chloroplast-based expression systems may be preferable as they provide the native environment for CP47 folding and assembly. Alternatively, heterologous systems must be engineered to supply chlorophyll during protein synthesis .

  • Co-expression strategies: Co-expressing chlorophyll synthesis enzymes alongside CP47 can ensure chlorophyll availability during protein translation. Additionally, co-expressing chaperones or assembly factors that naturally assist CP47 folding may improve yield of functional protein.

  • Induction and growth conditions: Light conditions must be carefully controlled to balance chlorophyll synthesis with protein expression. Temperature optimization is also critical, as lower temperatures often improve membrane protein folding by slowing translation and allowing more time for proper membrane integration.

  • Membrane mimetics: For in vitro studies, selecting appropriate membrane mimetics (detergents, nanodiscs, or liposomes) is crucial for maintaining CP47 in a native-like environment after purification. Tris-based buffers with glycerol have been shown to be effective for stabilization .

  • Storage optimization: Proper storage conditions are essential for maintaining recombinant CP47 stability. Storage at -20°C or -80°C in 50% glycerol is recommended, with minimized freeze-thaw cycles to prevent degradation .

What are the best approaches for studying CP47 interactions with assembly factors?

Several sophisticated approaches are particularly effective for studying CP47 interactions with assembly factors:

  • Cryo-electron microscopy: Recent advances in cryo-EM have provided breakthrough insights into CP47 interactions with assembly factors like Psb28, Psb34, and Hlips . This technique has revealed that Psb28 induces substantial structural changes to the cytoplasmic regions of D1 and D2 when bound to CP47-containing intermediates .

  • Crosslinking coupled with mass spectrometry: This approach identifies specific interaction sites between CP47 and assembly factors. Although early crosslinking experiments suggested different interaction partners for some assembly factors, newer techniques with improved specificity have refined our understanding of these interactions .

  • Pull-down assays with recombinant proteins: Using tagged versions of assembly factors or CP47 can help identify interaction partners and quantify binding affinities. This approach can be combined with competition assays to determine if different assembly factors compete for overlapping binding sites.

  • Genetic approaches: Analysis of mutants lacking specific assembly factors has provided valuable information about their roles in CP47 integration and PSII assembly. For example, studies showed that in a Psb28 null mutant of Synechocystis, RC47 levels are almost undetectable, suggesting Psb28 blocks assembly of newly formed PSII at the RC47 stage .

  • Time-resolved spectroscopy: This technique can monitor the dynamic interactions between CP47 and assembly factors during the assembly process, providing insights into the kinetics and sequential nature of these interactions.

What are the emerging technologies that could advance CP47 research?

Several emerging technologies show promise for advancing CP47 research:

  • Time-resolved cryo-EM: This developing technique could capture dynamic states during CP47 assembly and interaction with assembly factors, providing insights into the structural changes occurring during PSII biogenesis.

  • Single-molecule fluorescence techniques: These approaches can reveal heterogeneity in CP47-chlorophyll interactions and energy transfer pathways that are masked in ensemble measurements, providing new insights into function at the molecular level.

  • Advanced mass spectrometry: Hydrogen-deuterium exchange mass spectrometry and native mass spectrometry are increasingly being applied to membrane proteins and could reveal dynamic aspects of CP47 structure and interactions.

  • Computational approaches: Molecular dynamics simulations and machine learning-based structure prediction tools are becoming more accurate for membrane proteins and could help predict how mutations or environmental changes affect CP47 structure and function.

  • Synthetic biology tools: CRISPR-based techniques for precise genome editing in photosynthetic organisms will enable more sophisticated studies of CP47 variants in vivo, potentially revealing new functional insights.

How might understanding CP47 assembly contribute to improving photosynthetic efficiency?

Understanding CP47 assembly could contribute to improving photosynthetic efficiency through several approaches:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.