Recombinant Locusta migratoria ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Locusta migratoria ATP synthase subunit a (ATP6) is a mitochondrial protein critical for energy production in the migratory locust. ATP6 is a core component of the F<sub>O</sub> domain of ATP synthase, facilitating proton translocation across the inner mitochondrial membrane to drive ATP synthesis . Its recombinant form, produced via E. coli expression systems, enables detailed biochemical and pest-control studies .

Production and Purification

Recombinant ATP6 is synthesized in E. coli and purified under denaturing or native conditions .

ParameterDetails
Expression HostEscherichia coli
TagN-terminal His tag
Purity>90% (SDS-PAGE verified)
StorageLyophilized powder in Tris/PBS buffer (6% trehalose, pH 8.0) at -80°C

Functional Insights

ATP6 is indispensable for mitochondrial ATP synthesis:

  • RNA Interference (RNAi) Studies: Injection of dsRNA targeting ATP6 in L. migratoria reduced ATP content by >50%, leading to mortality within 1.5–5 days .

  • Enzymatic Activity: Oligomycin-sensitive ATP hydrolysis and synthesis are directly linked to ATP6 integrity .

  • Structural Stability: Mutations in ATP6 disrupt ATP synthase assembly, as observed in mitochondrial disorders .

Applications in Pest Control

ATP6 is a promising RNAi target for locust management:

  • Mortality Rates: 100 ng of dsATP6 caused 100% mortality in L. migratoria .

  • Mechanism: Silencing ATP6 disrupts energy metabolism, offering species-specific control .

Comparative Analysis

ATP6 conservation across species highlights its functional universality:

FeatureL. migratoria ATP6Human MT-ATP6Yeast homolog
Length225 aa226 aa256 aa
Key DomainsTransmembrane helicesProton channel interfaceRotary mechanism stabilization
Disease AssociationN/ANeuropathy, ataxia Respiratory defects

Research Implications

  • Biochemical Assays: Recombinant ATP6 enables structural studies of insect ATP synthase .

  • Pest Control: RNAi targeting ATP6 could reduce pesticide resistance .

  • Comparative Biology: Insights into ATP6 mutations inform mitochondrial disease research .

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand you may have specific requirements. Please indicate your preferred format during order placement, and we will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is preferred, please communicate this requirement in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
To ensure proper reconstitution, it is recommended to briefly centrifuge the vial prior to opening. This will collect the contents at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend incorporating 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which serves as a reference point for your convenience.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. To maintain optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
While the tag type is determined during production, we are open to your specific tag type requirements. If you have a preferred tag, please inform us and we will prioritize its development.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Locusta migratoria (Migratory locust)
Target Names
ATP6
Target Protein Sequence
MMTNLFSTFDPSTNLFNLSLNWTSTFLGLLLIPSMFWLMPSRINILWNKMNLNLHNEFKT LLGKNSFQGSTLILISIFIMMLFNNFMGLFPYIFTSTSHMTLTFSIALPMWMSFMLFGWI NNTNHMFTHLVPQGTPNALMSFMVLIETISNVIRPGTLAVRLAANMIAGHLLLTLLGNTG PSLTTSIMLFLIIGQMLLLILESAVAMIQAYVFSILSTLYSSEVY
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) is responsible for generating ATP from ADP in the presence of a proton gradient across the membrane. This gradient is established by the electron transport complexes of the respiratory chain. F-type ATPases consist of two distinct structural domains: F(1), encompassing the extramembraneous catalytic core, and F(0), containing the membrane proton channel. These domains are interconnected by a central stalk and a peripheral stalk. During catalysis, ATP synthesis within the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. A key component of the proton channel, this subunit may play a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is ATP synthase subunit a (ATP6) in Locusta migratoria and what is its biological significance?

ATP synthase subunit a (ATP6) is a critical component of the F0F1-ATP synthase complex in Locusta migratoria (migratory locust). This protein is part of the membrane-embedded F0 portion of ATP synthase that forms the proton channel. The ATP synthase complex utilizes proton or sodium motive force to produce approximately 90% of cellular ATP, making it essential for energy metabolism across all tissues .

The protein has a UniProt accession number of P14569 and consists of 225 amino acids in its full sequence. It contains multiple transmembrane regions that facilitate proton movement across the membrane, ultimately driving ATP synthesis . The biological significance of ATP6 lies in its fundamental role in cellular energy production, making it indispensable for all physiological processes in the locust.

How does ATP6 differ from other ATP synthase subunits studied in Locusta migratoria?

ATP6 differs significantly from other ATP synthase subunits such as ATP5A (α-subunit) in both structure and function:

FeatureATP6 (Subunit a)ATP5A (α-subunit)
LocationF0 sector (membrane-embedded)F1 sector (catalytic domain)
FunctionForms proton channelCatalytic activity for ATP synthesis
Size225 amino acidsLarger protein structure
ExpressionPresent in all tissuesExpressed in all tissues
Knock-down effectNot specifically documented in search resultsMortality in 1.5-5 days

While ATP5A has been more extensively studied and demonstrated as a potential RNAi target for pest management with documented lethal effects when knocked down , specific studies focusing on ATP6 knockdown effects in L. migratoria are more limited in the current literature.

What regulatory considerations apply to research involving recombinant Locusta migratoria ATP6?

Research involving recombinant Locusta migratoria ATP6 must comply with institutional and national regulations governing recombinant DNA work. Key regulatory considerations include:

  • NIH Guidelines Compliance: Institutions receiving NIH funding must follow the NIH Guidelines for Research Involving Recombinant or Synthetic Nucleic Acid Molecules, regardless of the funding source for the specific project .

  • IBC Registration: Most work with recombinant proteins requires registration with the Institutional Biosafety Committee (IBC) .

  • Risk Assessment: Researchers must determine the appropriate Risk Group (RG) and Biosafety Level (BSL) for their experiments involving recombinant ATP6 .

  • Project Classification: Research involving recombinant ATP6 would typically fall under Section III-D or III-E of the NIH Guidelines, depending on the specific experimental design .

Prior to initiating research, investigators should complete the appropriate registration documents for their IBC, detailing the source of the gene, the vector or method of transfection, and the recipient organism or cell system .

What expression systems are most effective for producing recombinant Locusta migratoria ATP6?

Based on research practices with similar membrane proteins, the following expression systems can be considered for recombinant L. migratoria ATP6 production:

Expression SystemAdvantagesConsiderations
E. coliFast growth, high yield, economicalMembrane proteins often form inclusion bodies; lacks post-translational modifications
Insect cells (Sf9, Sf21)Native-like post-translational modifications, better folding for insect proteinsMore expensive, slower growth than bacterial systems
Yeast (P. pastoris)Eukaryotic folding machinery, high-density culturesExpression levels can be variable
Cell-free systemsAvoids toxicity issues, direct access to reaction conditionsLower yields, more expensive

When expressing recombinant ATP6, researchers should consider using a tag system (e.g., His-tag) to facilitate purification, as indicated in commercial preparations . Storage conditions typically involve Tris-based buffer with 50% glycerol, and the recombinant protein should be stored at -20°C or -80°C for extended storage to maintain stability .

What techniques are recommended for functional analysis of recombinant Locusta migratoria ATP6?

Several methodological approaches can be employed to analyze the function of recombinant L. migratoria ATP6:

  • ATP Hydrolysis/Synthesis Assays: Measuring oligomycin-sensitive ATP synthetic and hydrolytic activities can provide functional insights. Similar approaches used with ATP5A showed reduced activity following gene knockdown .

  • RNA Interference (RNAi): Double-stranded RNA targeting ATP6 can be used to knock down expression and observe resultant phenotypes. This approach has proven successful with other ATP synthase subunits in L. migratoria .

  • Protein-Protein Interaction Analysis: Co-immunoprecipitation or crosslinking studies can help determine interactions between ATP6 and other subunits of the ATP synthase complex.

  • Cellular ATP Content Measurement: Quantifying ATP levels following manipulation of ATP6 expression can provide insights into its role in energy production. Studies with ATP5A showed reduced ATP content following dsRNA injection .

  • Electron Microscopy: Transmission electron microscopy can be used to observe structural changes in tissues following ATP6 manipulation, similar to approaches used for V-ATPases in L. migratoria .

How can RNA interference be optimized for studying ATP6 function in Locusta migratoria?

RNAi has proven effective for studying ATP synthase subunits in L. migratoria. Based on successful approaches with ATP5A and V-ATPases, the following protocol can be optimized for ATP6:

  • dsRNA Design: Design multiple dsRNA fragments (typically 300-500 bp) targeting different regions of the ATP6 mRNA sequence to identify the most effective knockdown construct.

  • Dosage Optimization: Begin with doses similar to those effective for ATP5A (approximately 100 ng of dsRNA), which caused knockdown and mortality in 1.5-5 days . Titrate as needed based on knockdown efficiency.

  • Delivery Method: Injection directly into the hemocoel is typically most effective for L. migratoria. Precise injection sites and volumes should be standardized across experiments .

  • Controls: Include both non-injected controls and controls injected with non-specific dsRNA (such as GFP-targeting dsRNA) to account for injection effects .

  • Validation: Confirm knockdown efficiency through qRT-PCR and western blotting to quantify reductions in mRNA and protein levels, respectively .

  • Phenotype Assessment: Monitor development, mortality, tissue morphology, and ATP levels to comprehensively assess the effects of ATP6 knockdown .

How does ATP6 potentially compare to ATP5A as a target for pest management strategies?

ATP5A has been established as a promising target for RNAi-mediated pest control of L. migratoria, with documented lethal effects following knockdown . Comparative analysis suggests ATP6 may have similar potential:

AspectATP5A as TargetATP6 as Potential Target
Essential FunctionVital for F1-ATP synthase activityCritical for proton channel formation in F0 sector
Knockdown EffectMortality in 1.5-5 daysLikely essential, but specific data not available in search results
Tissue ExpressionExpressed in all tissuesPresent across tissues
SpecificityPotential for species-specific targetingMay offer targeting opportunities based on sequence specificity
Technical ChallengesSuccessful dsRNA design establishedWould require optimization of dsRNA targeting

While ATP5A knockdown reduces transcription, protein levels, ATP synthetic/hydrolytic activities, and ATP content , similar comprehensive studies specifically on ATP6 would be necessary to fully evaluate its potential as a pest management target. The essential nature of ATP synthase in cellular energy production suggests ATP6 would likely be an effective target, but this requires experimental confirmation.

What are the current limitations in our understanding of ATP6 structure-function relationships in Locusta migratoria?

Several significant knowledge gaps exist regarding ATP6 structure-function relationships:

  • Proton Translocation Mechanism: Detailed understanding of how the specific amino acid sequence of L. migratoria ATP6 contributes to proton channel function remains limited.

  • Subunit Interactions: Comprehensive mapping of interactions between ATP6 and other ATP synthase subunits in L. migratoria has not been fully elucidated.

  • Species-Specific Variations: Comparative analyses of ATP6 across different insect species to identify unique structural elements that could be exploited for species-specific targeting are needed.

  • Post-Translational Modifications: Information about potential post-translational modifications of ATP6 in L. migratoria and their functional significance is lacking.

  • Inhibitor Binding Sites: Detailed mapping of potential inhibitor binding sites on L. migratoria ATP6 that could be targeted for pest management strategies requires further investigation.

These limitations present opportunities for research that could significantly advance both basic understanding of ATP synthase biology and applied pest management strategies.

What biosafety considerations should researchers address when working with recombinant ATP6 from L. migratoria?

Research involving recombinant L. migratoria ATP6 requires careful attention to biosafety protocols:

  • Risk Assessment: Conduct a thorough risk assessment considering the protein's function, potential for allergenicity, and any toxic properties. While ATP6 itself is not a toxin, proper risk assessment is essential for all recombinant work .

  • Biosafety Level Determination: Most work with recombinant ATP6 would typically be conducted at BSL-1, but this should be confirmed through institutional biosafety review .

  • IBC Registration: Complete registration with the Institutional Biosafety Committee, addressing:

    • Source of the gene (L. migratoria)

    • Cloning vector and expression system

    • Containment measures

    • Waste disposal procedures

  • NIH Guidelines Compliance: Ensure compliance with NIH Guidelines Section III-D or III-E, depending on the specific experimental design .

  • Laboratory Practices: Implement appropriate laboratory practices including:

    • Proper personal protective equipment

    • Work surfaces decontamination

    • Proper waste disposal

    • Prevention of aerosol generation during experimental procedures

How does ATP6 function compare between Locusta migratoria and other insects of agricultural importance?

Comparative analysis of ATP6 across insect species can provide insights for both basic research and potential pest management applications:

SpeciesATP6 CharacteristicsPotential Research Applications
Locusta migratoria225 amino acids; membrane-embedded proton channel component Pest management; basic ATP synthase biology
Other OrthopteraLikely similar structure but with species-specific variationsComparative genomics; selective targeting
Lepidoptera (moths, butterflies)Sequence variations in key functional regionsDifferential susceptibility to ATP synthase inhibitors
Diptera (flies, mosquitoes)Divergent evolutionary adaptationsEvolutionary biology of energy metabolism

What potential exists for ATP6-based technologies beyond pest management?

While pest management applications have been a focus for ATP synthase research in L. migratoria, ATP6 research has broader potential applications:

  • Bioenergetics Research: As a fundamental component of energy production, L. migratoria ATP6 can serve as a model for understanding basic principles of bioenergetics.

  • Evolutionary Biology: Comparative analysis of ATP6 across species can provide insights into the evolution of energy production systems and adaptation to different environmental conditions.

  • Structural Biology: Studies of L. migratoria ATP6 structure could contribute to understanding membrane protein folding and assembly mechanisms.

  • Biotechnology Applications: Engineered ATP6 variants could potentially be used in biotechnological applications requiring controlled energy production or proton gradients.

  • Educational Models: The well-characterized nature of ATP synthase makes L. migratoria ATP6 a potential educational model for teaching concepts in bioenergetics and membrane protein function.

What methodological advances are needed to overcome current technical challenges in ATP6 research?

Several technical challenges currently limit ATP6 research, requiring methodological innovations:

  • Improved Expression Systems: Development of expression systems specifically optimized for membrane proteins from insects would enhance yield and proper folding of recombinant ATP6.

  • Advanced Structural Analysis: Application of cryo-electron microscopy specifically to insect ATP synthase complexes would provide detailed structural insights currently lacking.

  • In vivo Tracking Methods: Development of techniques to track ATP6 localization and dynamics in living insect cells would advance understanding of its functional roles.

  • Tissue-Specific RNAi Delivery: Methods for targeted delivery of RNAi constructs to specific tissues would allow more precise functional studies without lethal effects.

  • High-Throughput Screening: Development of assays suitable for high-throughput screening of compounds interacting with L. migratoria ATP6 could accelerate discovery of specific modulators.

These methodological advances would significantly enhance the depth and breadth of ATP6 research, potentially leading to both fundamental insights and practical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.