Recombinant Locusta migratoria Cytochrome c oxidase subunit 2 (COII)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COII; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Locusta migratoria (Migratory locust)
Target Names
COII
Target Protein Sequence
MATWSNLSLQDGASPLMEQLSFFHDHTMIDLLLITMIVGYSLSYMLLTKYTNRNMLHGHL IETIWTALPAITLIFIALPSLRLLYLLDDSSDAMITIKTIGRQWYWSYEYSDFINVEFDT YMTPENELNTDEFRLLEVDNRTTLPMNTEVRVLTSASDVLHSWAVPALVLKIDATPGRLN QGMFMINRPGLFFGQCSEICGANHSFMPIVIESTSIKLFIKWLSNMM
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (COII) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II), ubiquinol-cytochrome c oxidoreductase (Complex III), and cytochrome c oxidase (Complex IV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis via ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c (in the intermembrane space) are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1, composed of heme a3 and CuB. The BNC uses four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (COII) and what is its significance in Locusta migratoria?

Cytochrome c oxidase subunit 2 (COII) is one of the core subunits of mitochondrial Cytochrome c oxidase (Cco), which functions as the terminal enzyme in the electron transport chain. In Locusta migratoria, as in other organisms, COII contains a dual core CuA active site that plays a critical role in cellular respiration. The protein is essential for the function of Complex IV in the electron transport chain, transferring electrons from cytochrome c to molecular oxygen and contributing to the generation of the proton gradient that drives ATP synthesis. COII is particularly significant in understanding the bioenergetics of migratory locusts, which require substantial energy resources during swarming and long-distance flight behaviors .

How does the structure of Locusta migratoria COII compare to that of other insect species?

While detailed structural information specific to Locusta migratoria COII is limited, comparative analysis with other insect species suggests significant conservation of structure and function. For example, studies of Sitophilus zeamais COII demonstrated that insect COII proteins share high sequence identity across species, particularly in regions containing functional domains like the CuA active site .

Multiple sequence alignment typically reveals that the core catalytic domains are highly conserved, while peripheral regions may show more variability. The molecular mass of recombinant COII is generally consistent across insect species, with the native protein typically around 26-30 kDa, though this can increase to approximately 44 kDa when expressed with fusion tags such as His-tags . This conservation reflects the fundamental importance of COII's function in cellular respiration across all insect taxa.

What are the optimal expression systems for producing recombinant Locusta migratoria COII?

For recombinant Locusta migratoria COII expression, E. coli systems, particularly Transetta (DE3) strains, have proven effective based on success with similar insect proteins . The choice of expression system should be guided by research objectives and required protein characteristics:

Expression SystemAdvantagesDisadvantagesOptimal For
E. coli (Transetta DE3)High yield, cost-effective, rapid growthLimited post-translational modificationsBasic functional studies
Insect cells (Sf9, Sf21)Native-like post-translational modificationsMore expensive, slower growthStructural studies requiring authentic modifications
Yeast (P. pastoris)High yield, some post-translational modificationsLonger optimization timeScale-up production
Cell-free systemsRapid, avoids toxicity issuesLower yield, expensiveDifficult-to-express proteins

For initial characterization studies, the bacterial expression system using pET vectors with IPTG induction has demonstrated success for similar insect oxidase subunits .

What purification protocols yield the highest purity and activity for recombinant Locusta migratoria COII?

The most effective purification strategy for recombinant Locusta migratoria COII involves affinity chromatography, specifically utilizing Ni(2+)-NTA agarose for His-tagged constructs . A comprehensive purification protocol should include:

  • Cell lysis: Using the Insect PopCulture® Reagent (0.05 volume added directly to culture) combined with Benzonase® Nuclease (10 U/mL) to reduce viscosity without centrifugation .

  • Affinity purification: Loading clarified lysate onto Ni(2+)-NTA resin, washing with increasing imidazole concentrations (20-50 mM), and eluting with high imidazole (250-500 mM) .

  • Secondary purification: For applications requiring higher purity, size-exclusion chromatography can separate the target protein from aggregates and contaminants.

Western blotting analysis typically shows recombinant COII with His-tag at approximately 44 kDa . This centrifugation-free approach significantly reduces processing time and captures proteins that might otherwise be lost during conventional cell harvesting .

How can researchers optimize COII expression to maximize yield and stability?

Optimization of recombinant Locusta migratoria COII expression requires systematic adjustment of several parameters:

ParameterOptimization RangeEffect on Expression
Induction temperature16-30°CLower temperatures (18-22°C) typically enhance solubility
IPTG concentration0.1-1.0 mM0.5 mM often provides optimal induction without toxicity
Induction timingOD600 0.6-1.0Induction at mid-log phase (OD600 0.8) often optimal
Induction duration4-24 hours16-20 hours at lower temperatures yields best results
Media compositionLB, TB, 2YTTB media can increase yield by 2-3 fold compared to LB

Including additives such as 1% glucose during growth and 5-10% glycerol in purification buffers can significantly enhance protein stability. For problematic expressions, co-expression with molecular chaperones (GroEL/GroES) has proven effective for other insect proteins with complex folding requirements .

What methods are most effective for assessing the enzymatic activity of recombinant Locusta migratoria COII?

The enzymatic activity of recombinant Locusta migratoria COII can be effectively assessed using several complementary approaches:

  • Spectrophotometric assays: Monitor the oxidation of reduced cytochrome c at 550 nm. The reaction rate can be calculated using the extinction coefficient (ε550) of 21.84 mM⁻¹cm⁻¹ for the reduced-minus-oxidized cytochrome c .

  • Polarographic measurements: Using an oxygen electrode to measure oxygen consumption rates can provide direct evidence of functional activity when the recombinant COII is reconstituted with other subunits.

  • Infrared spectrometry: This technique can reveal structural changes associated with substrate binding and catalysis, providing insights into the functional state of the protein .

For comparative analysis, enzyme kinetic parameters (Km, Vmax) should be determined under standardized conditions (pH 7.4, 25°C). Researchers have observed that recombinant insect COII proteins typically exhibit substrate (cytochrome c) Km values in the range of 5-15 μM, though this may vary based on preparation methods and buffer conditions .

How do substrate interactions and inhibitor studies provide insights into COII function?

Studies of substrate interactions and inhibitor effects can reveal critical functional aspects of recombinant Locusta migratoria COII:

  • Substrate specificity: While cytochrome c is the primary physiological substrate, testing with cytochrome c from different species can reveal specificity determinants. Typically, insect COII shows highest activity with insect cytochrome c, moderate activity with mammalian cytochrome c, and minimal activity with yeast cytochrome c.

  • Inhibitor studies: Various compounds affect COII activity, providing mechanistic insights:

Inhibitor TypeExample CompoundsIC50 RangeMechanism
Metal chelatorso-phenanthroline50-200 μMCuA center disruption
AnionsCyanide, azide10-50 μMBinds to metal centers
Natural compoundsAllyl isothiocyanate75-150 μMForms H-bond with specific residues (e.g., Leu-31)
Synthetic compoundsCertain pesticidesVariableSpecies-specific interactions

Molecular docking studies with allyl isothiocyanate (AITC) have demonstrated specific interactions with insect COII proteins. For example, a sulfur atom in AITC can form a hydrogen bond (2.9 Å length) with Leu-31 in the protein structure, affecting catalytic activity .

What techniques can reveal structure-function relationships in recombinant COII?

Understanding structure-function relationships in recombinant Locusta migratoria COII requires multi-faceted analytical approaches:

  • Circular dichroism (CD) spectroscopy: Provides information about secondary structure elements (α-helices, β-sheets) and can detect conformational changes upon substrate binding or under different conditions.

  • Limited proteolysis: Identifies flexible or exposed regions in the protein structure that may be involved in conformational changes during catalysis.

  • Site-directed mutagenesis: Systematic mutation of conserved residues, particularly those in the CuA binding site, can establish their roles in catalysis. Typical mutation targets include:

    • Conserved histidine residues coordinating copper ions

    • Hydrophobic residues lining the cytochrome c binding pocket

    • Interface residues involved in interaction with other subunits

  • Spectroscopic analysis of metal centers: UV-visible and EPR spectroscopy can provide detailed information about the electronic structure and coordination environment of the CuA center, which is essential for electron transfer.

These approaches collectively can elucidate how specific structural elements contribute to COII's catalytic function and interactions with other components of the electron transport chain.

How can recombinant Locusta migratoria COII be utilized in evolutionary and phylogenetic studies?

Recombinant Locusta migratoria COII offers valuable applications in evolutionary and phylogenetic research:

  • Molecular evolution studies: Comparing sequence, structure, and function of COII across insect orders can reveal evolutionary patterns in mitochondrial respiratory proteins. Multiple sequence alignment typically shows high conservation (>70%) in functional domains while allowing identification of clade-specific adaptations .

  • Phylogenetic marker: COII sequences can serve as effective markers for resolving relationships among closely related insect species, particularly within Orthoptera.

  • Adaptive evolution analysis: Comparative biochemical analysis of recombinant COII from Locusta migratoria and other insect species can reveal adaptive changes in enzymatic properties correlating with environmental factors or metabolic demands. For example, insects adapted to high-altitude environments often show COII modifications that enhance oxygen affinity.

  • Molecular clock applications: As a mitochondrial gene with relatively consistent evolutionary rate, COII can be used to estimate divergence times between locust populations and closely related species.

These applications require expression and characterization of COII from multiple species using standardized protocols to ensure comparability of functional data.

What insights can recombinant COII provide into locust physiology and bioenergetics?

Recombinant Locusta migratoria COII can advance our understanding of locust physiology and bioenergetics in several key areas:

  • Metabolic adaptation during swarming: By comparing the enzymatic properties of COII from solitary versus gregarious phases of Locusta migratoria, researchers can identify potential modifications in respiratory efficiency that support the increased energy demands during swarming behavior.

  • Temperature adaptation: Studies examining the thermal stability and activity of recombinant COII across temperature ranges can reveal how these insects maintain respiratory function during environmental temperature fluctuations, which is particularly relevant for understanding climate change impacts.

  • Developmental regulation: Analysis of COII expression and activity across different developmental stages (similar to studies in other insects) can illuminate how energy metabolism is regulated throughout the locust life cycle .

  • Tissue-specific isoforms or modifications: Comparing COII from different tissues may reveal tissue-specific adaptations in respiratory function, particularly between flight muscles and neural tissues which have distinct metabolic requirements.

These physiological insights are essential for understanding the remarkable capacity of locusts to sustain energy-intensive behaviors like long-distance migration and swarming.

How is recombinant Locusta migratoria COII employed in toxicological studies and pesticide development?

Recombinant Locusta migratoria COII serves as a valuable tool in toxicological research and targeted pesticide development:

  • Mode of action studies: Recombinant COII can be used to screen for compounds that specifically inhibit insect respiratory function. Research has demonstrated that compounds like allyl isothiocyanate (AITC) can interact with specific residues (e.g., forming a 2.9 Å hydrogen bond with Leu-31) in insect COII proteins .

  • Selective targeting: Comparative analysis of inhibitor binding to locust COII versus mammalian homologs can identify compounds with selectivity for insect respiratory systems, potentially leading to safer pesticides.

  • Resistance mechanism investigation: Mutations in COII that confer resistance to pesticides can be introduced into the recombinant protein to study their effects on enzyme function and inhibitor binding.

  • Nanotoxicology research: Locusta migratoria has been established as a model organism for investigating the effects of nanoparticles on insect physiology. Studies have shown that compounds like Al₂O₃ nanoparticles can affect cell viability in various locust tissues, including reproductive structures .

  • Biological control agent development: The effectiveness of entomopathogenic bacteria against locusts has been demonstrated, with strains like Xenorhabdus nematophila BA2 and Photorhabdus luminescens EGAP3 showing 85-89% mortality rates against Locusta migratoria nymphs in semi-field conditions . Understanding how these biological control agents affect respiratory function can inform integrated pest management strategies.

What are common challenges in cloning and expressing Locusta migratoria COII and how can they be addressed?

Researchers frequently encounter several challenges when working with Locusta migratoria COII:

ChallengeSymptomsSolution Strategies
Codon bias issuesLow expression levelsOptimize codons for expression host; use specialized strains (e.g., Rosetta) with rare tRNA genes
Toxicity to host cellsPoor growth after inductionUse tightly regulated promoters; lower induction temperature (16-18°C); reduce IPTG concentration (0.1-0.2 mM)
Inclusion body formationInsoluble protein in pellet fractionExpress at lower temperatures; co-express with chaperones; add solubility enhancers (0.5-1% Triton X-100, 5-10% glycerol)
Proteolytic degradationMultiple bands or smears on SDS-PAGEAdd protease inhibitor cocktail; use protease-deficient host strains; optimize purification speed
Poor amplification from cDNAWeak or no PCR productDesign primers based on conserved regions from related species; use touchdown PCR protocols; optimize GC-rich PCR conditions

When encountering difficulties with direct cloning, researchers have successfully employed alternative strategies such as gene synthesis with optimized codons, which can increase expression yields by 3-5 fold compared to native sequences .

How can researchers verify the structural integrity and functional activity of purified recombinant COII?

A comprehensive validation approach for recombinant Locusta migratoria COII should include multiple complementary techniques:

  • Structural integrity verification:

    • SDS-PAGE analysis: Should show a single band at expected molecular weight (~26 kDa for tag-free protein, ~44 kDa with fusion tags)

    • Western blotting: Confirms identity using antibodies against COII or tag epitopes

    • Mass spectrometry: Provides accurate mass and sequence coverage (>80% coverage indicates good integrity)

    • Circular dichroism: Confirms proper secondary structure (COII typically shows mixed α/β content)

  • Functional validation:

    • Cytochrome c oxidation assay: Measures the rate of cytochrome c oxidation spectrophotometrically at 550 nm

    • UV-visible spectroscopy: Characteristic absorbance peaks for CuA center (480-500 nm range)

    • Thermal shift assay: Properly folded protein should show cooperative unfolding with Tm typically in the range of 45-55°C

  • Ligand binding assessment:

    • Isothermal titration calorimetry: Determines binding affinity with cytochrome c (typical Kd values in 1-10 μM range)

    • Enzyme kinetics: Systematic analysis of reaction rates at varying substrate concentrations to determine Km and Vmax

A properly folded and functional recombinant COII should exhibit consistent values across these parameters in comparison to native or previously characterized recombinant insect COII proteins .

What approaches can resolve protein aggregation and solubility issues with recombinant COII?

Protein aggregation and solubility challenges with recombinant Locusta migratoria COII can be addressed through systematic optimization:

  • Buffer optimization matrix:

ComponentTest RangeOptimal Conditions
pH6.0-8.5Typically 7.2-7.8 for insect COII
NaCl concentration50-500 mM150-250 mM often optimal
Glycerol5-20%10% stabilizes without increasing viscosity
Detergents0.05-1% various non-ionic0.1% DDM or 0.5% CHAPS often effective
Reducing agents1-10 mM DTT or β-ME5 mM DTT typically sufficient
  • Refolding strategies for inclusion bodies:

    • On-column refolding: Bind denatured protein to affinity resin, then apply decreasing urea gradient (8M to 0M)

    • Dilution method: Rapid dilution into refolding buffer containing arginine (0.5-1M) and a redox pair (reduced/oxidized glutathione)

    • Step-wise dialysis: Gradual removal of denaturant through sequential dialysis steps

  • Solubility-enhancing fusion partners:

    • MBP (maltose-binding protein): Typically increases solubility 2-5 fold compared to His-tag alone

    • SUMO: Enhances solubility and can be precisely removed to leave native N-terminus

    • Thioredoxin: Effective for proteins with disulfide bonds

  • Co-expression strategies:

    • Molecular chaperones (GroEL/GroES, DnaK/DnaJ): Assist proper folding

    • Copper chaperones: May enhance proper metallation of the CuA center

Researchers have successfully employed centrifugation-free extraction methods using PopCulture reagent to obtain functional cytochrome proteins, which can help preserve native structural properties that might be compromised during conventional purification procedures .

What emerging technologies are advancing Locusta migratoria COII research?

Several cutting-edge technologies are transforming research on Locusta migratoria COII and related proteins:

  • Cryo-electron microscopy (cryo-EM): Enables high-resolution structural analysis of membrane protein complexes without crystallization, potentially revealing how COII integrates within the complete cytochrome c oxidase complex.

  • HDX-MS (hydrogen-deuterium exchange mass spectrometry): Provides insights into protein dynamics and conformational changes during substrate binding and catalysis.

  • Single-molecule techniques: FRET (Förster resonance energy transfer) approaches can monitor real-time conformational changes during electron transfer.

  • Nanobody development: Camelid antibody fragments that can stabilize specific conformational states of COII, facilitating structural studies and potentially modulating function.

  • CRISPR/Cas9 genome editing: Enables precise modification of COII sequences in live locusts to study physiological impacts of specific mutations.

These technologies collectively promise to bridge the gap between molecular understanding and physiological function of COII in Locusta migratoria .

How does COII research contribute to sustainable locust management strategies?

Research on Locusta migratoria COII has significant implications for developing sustainable pest management approaches:

  • Biorational insecticide development: The detailed structural and functional characterization of COII enables the design of compounds that selectively target insect respiratory systems. Studies on recombinant COII provide the molecular basis for identifying compounds that bind specifically to insect COII without affecting mammalian homologs.

  • Biological control integration: Entomopathogenic bacteria like Xenorhabdus nematophila BA2 and Photorhabdus luminescens EGAP3 have demonstrated high efficacy against Locusta migratoria nymphs (85-89% mortality in semi-field conditions) . Understanding how these bacteria affect COII function can help optimize their application in integrated management strategies.

  • Resistance monitoring: Characterization of COII variants can facilitate molecular monitoring for the emergence of resistance to respiratory inhibitors in locust populations.

  • Environmental impact assessment: Studies comparing the effects of potential control agents on locust COII versus homologs in non-target organisms can inform ecological risk assessments, contributing to more environmentally responsible pest management practices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.