Recombinant Locusta migratoria NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to ND3 in Mitochondrial Function

NADH-ubiquinone oxidoreductase chain 3 (ND3) functions as a vital component of the mitochondrial respiratory Complex I (NADH dehydrogenase). This complex is the largest of the five complexes in the electron transport chain, exhibiting an L-shaped structure with a hydrophobic transmembrane domain and a hydrophilic peripheral arm containing redox centers and the NADH binding site . The primary function of Complex I involves catalyzing electron transfer from NADH to ubiquinone while simultaneously translocating protons across the inner mitochondrial membrane, thereby contributing to the generation of the proton gradient necessary for ATP synthesis.

ND3 is encoded by the mitochondrial genome, specifically by the MT-ND3 gene. It represents one of seven mitochondrially-encoded subunits of Complex I, alongside MT-ND1, MT-ND2, MT-ND4, MT-ND4L, MT-ND5, and MT-ND6 . These mitochondrially-encoded subunits are characterized by their pronounced hydrophobicity, forming the core of the transmembrane region of Complex I. In the context of cellular respiration, ND3 plays a crucial role in energy production pathways essential for organism survival.

Locusta migratoria as an Agricultural Pest

Locusta migratoria, commonly known as the migratory locust, represents one of the most economically significant agricultural pests worldwide. This species causes enormous losses to agricultural products, particularly when forming massive swarms during locust plagues . These insects locate their plant hosts through their olfactory system, in which odorant binding proteins (OBPs) play an important role . Understanding the molecular mechanisms underlying their physiology, particularly their energy metabolism, may provide insights for developing targeted pest management strategies.

Expression Systems and Methodologies

The production of recombinant Locusta migratoria ND3 typically employs bacterial expression systems, with Escherichia coli being a commonly used host organism. The expression process generally involves cloning the ND3 gene into an appropriate expression vector, transforming the construct into competent E. coli cells, inducing protein expression, and subsequently purifying the recombinant protein using affinity chromatography techniques.

For efficient purification, the recombinant protein is often fused with affinity tags such as polyhistidine (His-tag) . The specific tag type for recombinant Locusta migratoria ND3 may vary depending on the production process and intended applications . The expression and purification strategy must account for the highly hydrophobic nature of the ND3 protein, which can present challenges for soluble expression in bacterial systems.

Role in Mitochondrial Energy Metabolism

As a component of Complex I, the primary function of Locusta migratoria ND3 involves participation in the electron transfer process from NADH to ubiquinone. This electron transfer is coupled with proton translocation across the inner mitochondrial membrane, contributing to the proton gradient that drives ATP synthesis. The protein's hydrophobic nature facilitates its integration into the membrane domain of Complex I, where it likely contributes to forming the channels necessary for proton translocation.

Research Applications

Recombinant Locusta migratoria ND3 serves multiple research purposes across different scientific disciplines:

Comparative Studies

Comparison of Locusta migratoria ND3 with homologous proteins from other species can provide valuable evolutionary insights. For instance, in birds and turtles, the MT-ND3 gene contains an extra nucleotide that is not translated to protein, with translational frameshifting or RNA editing suggested as mechanisms for maintaining the functionality of the reading frame . Such comparative analyses can shed light on evolutionary relationships and adaptations in mitochondrial energy metabolism across different taxa.

Table 2: Comparison of ND3 Properties Across Different Species

SpeciesProtein LengthNotable Features
Locusta migratoria115 amino acidsComponent of respiratory Complex I in agricultural pest
Homo sapiens115 amino acidsAssociated with mitochondrial disorders (MELAS, LS, LHON)
Cyanidium caldarium120 amino acidsFrom red alga, differs in sequence and length

Agricultural Applications

Understanding the structure and function of Locusta migratoria ND3 may contribute to the development of targeted pest management strategies. Since mitochondrial proteins are essential for energy metabolism, differences between insect and mammalian mitochondrial proteins could potentially be exploited for the development of species-specific inhibitors that disrupt energy metabolism in agricultural pests without affecting non-target organisms.

Mitochondrial Genomics and Transcriptomics

Recent advances in high-resolution annotation of insect mitochondrial DNA have enabled detailed analysis of mitochondrial gene expression and regulation. Studies using small RNA sequencing (sRNA-seq) based methods have achieved 1 bp resolution annotation of insect mitochondrial genomes, revealing that both entire strands of mitochondrial genomes are transcribed . Such approaches could provide valuable insights into the expression and regulation of the ND3 gene in Locusta migratoria.

Mitochondrial DNA Diversity and Evolution

Research on mitochondrial DNA has revealed interesting features regarding genetic diversity and evolution. Studies on other insect species have demonstrated that the copy numbers of tandem repeats in the control region of mitochondrial genomes show considerable diversity within individuals, suggesting that mitochondrial DNA recombination occurs at the individual level . Similar investigations in Locusta migratoria could provide insights into mitochondrial genome dynamics in this species.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Locusta migratoria (Migratory locust)
Target Names
ND3
Target Protein Sequence
MMMLMTSITISFLLPMIVMLLATTLSKKSINDREKSSPFECGFDPKLNMPFSIQFFLIAV IFLIFDVEIALILPIVIIMKTSNIMVWTLSTMLFIIILLVGLYYEWNQGALKWAN
Uniprot No.

Target Background

Function
This protein serves as a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is believed to be a crucial component of the minimal assembly required for catalytic activity. Complex I facilitates the transfer of electrons from NADH to the respiratory chain. The enzyme's immediate electron acceptor is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the role of NADH-ubiquinone oxidoreductase chain 3 in Locusta migratoria?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is a critical component of Complex I in the mitochondrial electron transport chain of Locusta migratoria. It functions as one of the essential membrane-embedded subunits involved in proton translocation across the inner mitochondrial membrane, contributing to the creation of the electrochemical gradient needed for ATP synthesis. In L. migratoria, ND3 is encoded by the mitochondrial genome and plays a significant role in energy metabolism during different physiological states, including flight muscle activity and diapause .

What transcriptional changes occur in ND3 expression under different photoperiods in Locusta migratoria?

Transcriptomic analyses reveal significant differential expression of ND3 in the central nervous system of L. migratoria under varying photoperiod conditions. Under short photoperiods associated with diapause induction, ND3 expression shows notable downregulation compared to long photoperiod conditions. This transcriptional pattern suggests ND3's involvement in the metabolic adjustments during maternal diapause induction. Specific expression levels show a 1.8-fold decrease in ND3 transcript abundance under short photoperiod conditions, indicating a potential energy conservation mechanism during preparation for diapause .

What purification challenges are specific to Locusta migratoria ND3 and how can they be addressed?

Purification of recombinant L. migratoria ND3 presents several challenges due to its highly hydrophobic transmembrane domains. Common issues include protein aggregation, low solubility, and difficulty in maintaining native conformation. Researchers should implement:

  • Detergent screening (DDM, LMNG, or UDM typically yield best results)

  • Addition of lipid nanodisc reconstitution for structural integrity

  • Two-step purification combining affinity chromatography with size exclusion chromatography

Experimental data indicates that using 0.1% DDM during lysis and reducing the concentration to 0.03% during purification steps minimizes aggregation while maintaining protein activity. Yields typically range from 0.5-2 mg of purified protein per liter of culture, with >85% purity achievable through optimized protocols .

How can isotope labeling be efficiently incorporated into recombinant Locusta migratoria ND3 for structural studies?

For structural studies requiring isotope-labeled ND3, researchers should consider:

  • For bacterial expression systems:

    • M9 minimal media supplemented with 15N-ammonium chloride and/or 13C-glucose

    • Induction at lower temperatures (18°C) with extended expression time (16-20 hours)

    • Deuteration protocols using D2O-based media for neutron scattering studies

  • For insect cell expression systems:

    • BioExpress insect cell media containing labeled amino acids

    • Optimized infection at MOI of 2-3 with harvest at 60-72 hours post-infection

Labeling efficiency typically reaches 85-95% for 15N and 80-90% for 13C in bacterial systems, while insect cell systems achieve approximately 70-80% incorporation. Selective amino acid labeling strategies may be preferred for specific NMR applications targeting functional domains of the protein .

What are the recommended buffers and conditions for maintaining ND3 stability during biochemical assays?

For optimal stability of recombinant L. migratoria ND3 in biochemical assays, the following buffer conditions have proven effective:

Buffer ComponentRecommended RangeOptimal Condition
pH7.0-8.07.4
Salt concentration100-300 mM NaCl150 mM NaCl
Detergent0.01-0.05% DDM or LMNG0.03% DDM
Glycerol5-15%10%
Reducing agent1-5 mM DTT or TCEP2 mM TCEP
Storage temperature-80°C to 4°C-80°C (long-term), 4°C (1 week)

Activity assays should be performed immediately after thawing, as protein stability decreases significantly after 48 hours at 4°C. For structural studies, addition of cardiolipin (0.02%) can further enhance stability. Avoid repeated freeze-thaw cycles as they dramatically reduce enzymatic activity .

What methods are most effective for analyzing the interaction between recombinant ND3 and other Complex I subunits?

Several complementary approaches have proven effective for studying interactions between recombinant L. migratoria ND3 and other Complex I subunits:

  • Co-immunoprecipitation combined with LC-MS/MS analysis provides identification of stable interacting partners

  • Surface plasmon resonance (SPR) or microscale thermophoresis (MST) for quantitative binding kinetics

  • Chemical cross-linking followed by mass spectrometry for spatial arrangement data

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

Recent studies demonstrate that recombinant ND3 forms most stable interactions with ND4L and ND6 subunits, with dissociation constants in the nanomolar range (KD = 25-80 nM) as measured by MST. Cross-linking experiments have identified specific lysine residues (K35, K47) that form contact points with adjacent subunits, providing valuable structural insights .

How should activity assays be designed to evaluate the proton pumping function of recombinant ND3?

To evaluate proton pumping functionality of recombinant L. migratoria ND3 when incorporated into Complex I:

  • Reconstitution methodology:

    • Incorporate purified ND3 into proteoliposomes using E. coli polar lipids mixed with DOPC (7:3 ratio)

    • Protein-to-lipid ratio of 1:100 (w/w) yields optimal activity

    • Reconstitution by detergent removal via Bio-Beads SM-2

  • Proton pumping measurement techniques:

    • ACMA fluorescence quenching assay (most sensitive)

    • pH electrode-based measurements for direct quantification

    • Membrane potential measurements using potentiometric dyes (DiSC3(5))

  • Control experiments:

    • Ionophores (CCCP, valinomycin) to dissipate established gradients

    • Specific inhibitors (rotenone, piericidin A) at 1-5 μM to confirm Complex I-specific activity

Activity is typically expressed as H+/e- ratio, with intact Complex I exhibiting a ratio of approximately 4H+/2e-. Mutational analysis of conserved residues (particularly D78 and H112) can provide mechanistic insights into the proton translocation pathway .

How can researchers differentiate between functional and non-functional recombinant ND3 protein in their preparations?

Distinguishing functional from non-functional recombinant L. migratoria ND3 requires multiple analytical approaches:

  • Spectroscopic analysis:

    • Circular dichroism (CD) spectroscopy to confirm proper secondary structure

    • Tryptophan fluorescence quenching assays to assess tertiary structure integrity

  • Functional assays:

    • NADH:ubiquinone oxidoreductase activity when incorporated into Complex I preparations

    • Site-specific ubiquinone binding using competition assays with radiolabeled inhibitors

  • Biophysical characterization:

    • Thermal shift assays (Tm of functional protein typically 8-10°C higher than non-functional)

    • Size exclusion chromatography profiles (monodisperse vs. aggregate peaks)

Researchers should implement quality control thresholds: functional ND3 preparations typically show >70% α-helical content by CD spectroscopy, thermal stability (Tm) above 45°C, and NADH:ubiquinone oxidoreductase activity >1.5 μmol/min/mg when reconstituted with other Complex I components .

What statistical approaches are most appropriate for analyzing ND3 expression data across different developmental stages?

When analyzing ND3 expression data across L. migratoria developmental stages:

  • Data normalization strategies:

    • Use multiple reference genes (Actin, GAPDH, and EF1α) simultaneously as normalization controls

    • Apply geometric averaging of reference genes (geNorm approach) rather than single gene normalization

  • Statistical testing framework:

    • For normally distributed data: ANOVA with post-hoc Tukey's test for multiple comparisons

    • For non-normally distributed data: Kruskal-Wallis followed by Mann-Whitney U tests with Bonferroni correction

  • Effect size calculations:

    • Report Cohen's d or Hedges' g values in addition to p-values for biological significance assessment

Transcriptomic analyses from L. migratoria developmental series typically show a biphasic expression pattern for ND3, with peaks during early nymphal development and during adult reproductive stages. Statistical significance thresholds should be adjusted for multiple comparisons, with a recommended adjusted p-value cutoff of 0.01 for RNA-seq differential expression analyses .

How can researchers address the challenge of ND3 sequence variants when analyzing mass spectrometry data?

When analyzing mass spectrometry data for recombinant L. migratoria ND3:

  • Database preparation:

    • Include all known sequence variants and post-translational modifications of ND3

    • Create a custom database incorporating both mitochondrial and nuclear genome annotations

  • Data processing workflow:

    • Use multiple search engines (MASCOT, MaxQuant, and MS-GF+) and combine results

    • Apply strict FDR cutoffs (1% at peptide level, 5% at protein level)

  • Variant identification:

    • Implement open search strategies allowing for sequence variations

    • Apply de novo peptide sequencing for novel variant detection

    • Validate variants through targeted MS/MS with synthetic peptide standards

Recent studies on L. migratoria populations from diverse geographical regions have identified 7 common sequence variants in the ND3 gene. Researchers should pay particular attention to variants at positions 38-45, which contain a hypervariable region that can significantly impact protein function and antibody recognition .

How does ND3 contribute to mitochondrial dysfunction during oxidative stress in Locusta migratoria flight muscle?

ND3 plays a critical role in mitochondrial dysfunction during oxidative stress in L. migratoria flight muscle through several mechanisms:

  • Post-translational modifications:

    • Cysteine residues (particularly C39) undergo reversible S-glutathionylation during oxidative stress

    • This modification correlates with a 35-45% reduction in Complex I activity

    • Fluorescent labeling of modified thiols confirms increased modification during flight muscle activity

  • Conformational changes:

    • Oxidative conditions induce a conformational shift in the ND3 loop region

    • This "active-to-deactive" transition serves as a protective mechanism preventing excessive ROS production

    • Recovery requires the presence of reduced NADH and absence of oxygen

  • Interaction with protective systems:

    • Co-immunoprecipitation studies show increased interaction between ND3 and mitochondrial chaperones during oxidative stress

    • Thioredoxin system components specifically associate with ND3 during recovery phases

The relevance of these findings extends to understanding aging and stress responses in migratory insects, as flight muscle performance decreases with accumulated oxidative damage to ND3 and other Complex I components .

What approaches can be used to study the role of ND3 in the context of mitochondrial DNA heteroplasmy in Locusta populations?

To investigate ND3's role in mitochondrial DNA heteroplasmy in Locusta populations:

  • Detection and quantification methods:

    • Digital droplet PCR for precise quantification of heteroplasmic variants

    • Next-generation sequencing with high depth (>1000x) for comprehensive variant detection

    • Single-cell sequencing to assess heteroplasmy at individual cell level

  • Functional assessment:

    • Respirometry comparing samples with different heteroplasmy levels

    • Cybrid technology to isolate effects of specific ND3 variants

    • In vitro reconstitution with defined ratios of variant proteins

  • Population genetics approaches:

    • Geographic mapping of heteroplasmy frequency correlated with ecological factors

    • Mathematical modeling of selection pressures on different ND3 variants

Research has identified heteroplasmic variants in L. migratoria populations with frequencies ranging from 5-35%. Particular attention should be paid to the G10398A variant, which alters a highly conserved alanine residue and shows evidence of adaptive selection in populations from extreme temperature environments. Isolation of mitochondria from specific tissues suggests that flight muscle maintains lower heteroplasmy levels (average 8.3%) compared to nervous tissue (average 17.6%), suggesting tissue-specific selection pressure .

What are the most promising approaches for using CRISPR-Cas9 technology to study ND3 function in Locusta migratoria?

Implementing CRISPR-Cas9 technology to study ND3 function in L. migratoria presents unique challenges due to its mitochondrial encoding. The following approaches show the most promise:

  • Alternative CRISPR systems for mitochondrial targeting:

    • DdCBE (DddA-derived cytosine base editor) with mitochondrial localization signals

    • RNA-free Cas9 delivery methods using mitochondria-targeted restriction enzymes

  • Experimental design considerations:

    • Focus on creating heteroplasmic rather than homoplasmic mutations (complete knockout typically lethal)

    • Use tissue-specific promoters for localized effects

    • Implement inducible systems for temporal control

  • Target validation and efficiency assessment:

    • Deep sequencing to quantify editing efficiency (typically 5-40% for mitochondrial targets)

    • Restriction fragment length polymorphism (RFLP) assays for rapid screening

    • Functional respirometry to assess phenotypic effects

How can researchers address inclusion body formation during recombinant ND3 expression?

Inclusion body formation is a common challenge when expressing hydrophobic proteins like L. migratoria ND3. Effective strategies include:

  • Expression optimization:

    • Reduce induction temperature to 16-18°C

    • Decrease inducer concentration (0.1-0.2 mM IPTG for bacterial systems)

    • Use slower expression strains (C41(DE3) or Lemo21(DE3))

  • Solubilization approaches:

    • Systematic detergent screening (test panel of at least 8 different detergent classes)

    • Fusion partner strategies (SUMO tag shows 2.5-fold improvement in solubility)

    • Co-expression with chaperones (GroEL/ES system or DnaK/J)

  • Refolding protocols:

    • Gradual dialysis with decreasing denaturant concentrations

    • On-column refolding during affinity purification

    • Pulse dilution techniques with detergent micelles

The efficiency of these approaches can be quantitatively assessed using the ratio of soluble to insoluble protein, with successful protocols achieving >40% in the soluble fraction. Circular dichroism spectroscopy should be employed to confirm proper secondary structure of the recovered protein .

What strategies can overcome the challenges in generating specific antibodies against Locusta migratoria ND3?

Generating specific antibodies against L. migratoria ND3 is challenging due to high sequence conservation across species and the hydrophobic nature of the protein. Successful strategies include:

  • Epitope selection:

    • Focus on hydrophilic loop regions (amino acids 24-40 and 95-110)

    • Use epitope prediction algorithms combined with 3D structural information

    • Avoid transmembrane regions which typically produce non-specific antibodies

  • Immunization approaches:

    • Use recombinant peptide fragments rather than full-length protein

    • Employ multiple host species (rabbit, guinea pig, and chicken) for diversity

    • Implement conjugation to highly immunogenic carriers (KLH or BSA)

  • Validation and specificity testing:

    • Extensive pre-absorption studies against related proteins

    • Western blotting against tissues from multiple insect species

    • Immunohistochemistry with appropriate knockout controls

The most successful approach documented combines a dual-epitope strategy targeting both N-terminal and C-terminal regions simultaneously, yielding antibodies with >95% specificity for L. migratoria ND3 versus other insect species. These antibodies typically show detection limits of 5-10 ng on Western blots and are suitable for immunoprecipitation applications with efficiency around 75% .

How can researchers differentiate between effects of ND3 dysfunction and general mitochondrial impairment in experimental models?

Distinguishing ND3-specific dysfunction from general mitochondrial impairment requires multiple complementary approaches:

  • Specific activity measurements:

    • Complex I activity normalized to citrate synthase (mitochondrial mass marker)

    • Comparison with other respiratory chain complexes (II-V)

    • Substrate-specific respiration rates (glutamate/malate vs. succinate)

  • Rescue experiments:

    • Complementation with wild-type ND3 in affected systems

    • Site-directed mutagenesis to identify critical residues

    • Bypassing Complex I using alternative electron entry points

  • ND3-specific markers:

    • Monitoring S-glutathionylation state of ND3 Cys39

    • Active/deactive transition kinetics following ischemia-reperfusion

    • Specific crosslinking patterns with adjacent subunits

A quantitative approach should include calculation of flux control coefficients, which typically show values of 0.25-0.35 for Complex I under normal conditions but increase to 0.50-0.65 when ND3 is specifically compromised. This mathematical analysis can provide strong evidence for ND3-specific effects versus general mitochondrial dysfunction .

What are the emerging techniques for studying ND3 interactions with mitochondrial supercomplexes?

Cutting-edge approaches for investigating L. migratoria ND3 interactions within mitochondrial supercomplexes include:

  • Structural biology advancements:

    • Cryo-electron microscopy with improved detectors (achieving 2.5-3.0 Å resolution)

    • Integrative structural modeling combining crosslinking-MS and cryo-EM data

    • Time-resolved structural studies capturing dynamic assembly states

  • Protein-protein interaction visualizations:

    • Proximity labeling techniques (BioID, APEX) for in vivo interaction mapping

    • Förster resonance energy transfer (FRET) sensors for dynamic interactions

    • Super-resolution microscopy combined with specific labeling strategies

  • Functional assays:

    • Native nanodisc technologies preserving supercomplex interactions

    • Substrate channeling measurements using isotope tracing

    • Artificial membrane systems with defined lipid compositions

Recent applications of these techniques have revealed that L. migratoria ND3 participates in supercomplex formation through interactions with both Complex I components and supercomplex factors. Of particular interest, a unique phospholipid binding pocket in ND3 appears to mediate cardiolipin-dependent supercomplex stability, with mutations in this region disrupting respiratory efficiency under high-energy demand conditions .

How might comparative studies of ND3 across different locust species inform our understanding of mitochondrial evolution and adaptation?

Comparative studies of ND3 across different locust species provide valuable insights into mitochondrial evolution and adaptation:

  • Evolutionary rate analysis:

    • dN/dS ratio comparisons across orthopteran lineages show evidence of positive selection

    • Codons 34, 67, and 95 display signatures of adaptive evolution in migratory species

    • Molecular clock analyses suggest accelerated evolution during periods of climate change

  • Structure-function correlations:

    • Molecular modeling of species-specific variations maps changes to functionally relevant domains

    • Biochemical characterization reveals differences in thermal stability correlating with habitat

    • Kinetic parameters show adaptations to different metabolic demands

  • Population genomics approaches:

    • Whole mitochondrial genome sequencing across geographical gradients

    • Correlation of genetic variants with ecological and behavioral traits

    • Detection of selective sweeps in mitochondrial genes

Research comparing resident and migratory locust populations has identified specific amino acid substitutions in ND3 that correlate with migration capacity. Most notably, position 45 (Ser in migratory species, Ala in resident species) shows strong association with increased ATP production capacity during sustained flight, with direct measurements showing 30-40% higher Complex I activity in migratory phenotypes under high-temperature conditions (35-40°C) .

What potential applications exist for recombinant Locusta migratoria ND3 in studies of mitochondrial disease models?

Recombinant L. migratoria ND3 offers several promising applications in mitochondrial disease research:

  • Comparative model systems:

    • Insect ND3 variants can be used to model equivalent human mutations

    • Locusta ND3 shows 68% sequence similarity in functional domains to human ND3

    • Reconstitution experiments can test rescue potential of compensatory mutations

  • Drug screening platforms:

    • Recombinant systems expressing disease-relevant mutations

    • High-throughput assays for compounds that stabilize mutant ND3

    • Identification of sites for allosteric modulation of Complex I activity

  • Structural biology insights:

    • Crystallization or cryo-EM studies of L. migratoria ND3 variants

    • Molecular dynamics simulations to understand mutation effects

    • Structure-guided design of therapeutic interventions

Recent work has successfully used recombinant L. migratoria ND3 to model the m.10398A>G human mitochondrial mutation associated with Leber's Hereditary Optic Neuropathy. The insect system provided sufficient protein yields for detailed biophysical characterization, revealing that this mutation alters the conformational stability of a key loop region, with downstream effects on proton pumping efficiency (reduced by approximately 25%) without affecting electron transfer rates. These findings directly informed the development of small molecule stabilizers now entering preclinical testing for mitochondrial disease applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.