Recombinant Lodderomyces elongisporus Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lodderomyces elongisporus Altered Inheritance of Mitochondria Protein 31 (AIM31)

Recombinant Lodderomyces elongisporus Altered Inheritance of Mitochondria Protein 31, mitochondrial (AIM31) is a recombinant protein derived from the yeast Lodderomyces elongisporus. This protein is specifically involved in mitochondrial functions, particularly in the context of altered inheritance of mitochondria, which can impact cellular processes such as energy metabolism and cell division.

Overview of AIM31

  • Protein Details: The AIM31 protein in Lodderomyces elongisporus is a mitochondrial protein, which suggests its role in mitochondrial function and dynamics. The recombinant form of this protein is expressed in Escherichia coli and is fused with an N-terminal His tag for easy purification and identification .

  • Sequence and Structure: The protein consists of 154 amino acids (1-154aa) and is identified by the accession number A5E2M7 .

Role in Mitochondrial Function

Mitochondrial proteins like AIM31 are crucial for maintaining mitochondrial integrity and function. They can be involved in processes such as mitochondrial DNA inheritance, mitochondrial dynamics (fusion and fission), and the regulation of mitochondrial protein synthesis.

Comparison with Other Mitochondrial Proteins

Other mitochondrial proteins, such as those involved in ribosome assembly (e.g., Mam33 in Saccharomyces cerevisiae), highlight the complexity of mitochondrial biogenesis and function . While AIM31's specific role is less documented compared to proteins like Mam33, its involvement in mitochondrial processes underscores its potential importance in cellular metabolism.

Expression and Purification

The recombinant AIM31 protein is expressed in E. coli, which is a common host for recombinant protein production due to its ease of manipulation and high yield. The His tag facilitates purification using affinity chromatography .

Potential Applications

  1. Biological Studies: AIM31 can be used to study mitochondrial dynamics and inheritance in Lodderomyces elongisporus, providing insights into how this yeast maintains its mitochondrial function.

  2. Biotechnology: Recombinant proteins like AIM31 can serve as tools for developing new biotechnological applications, such as improving yeast strains for industrial use.

Investigating AIM31 Function

Future studies should focus on elucidating the specific role of AIM31 in mitochondrial function and its impact on cellular processes. This could involve genetic manipulation of Lodderomyces elongisporus to observe phenotypic changes upon AIM31 disruption or overexpression.

Comparative Analysis

Comparative studies with other mitochondrial proteins from different organisms could provide broader insights into the conservation and divergence of mitochondrial functions across species.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
RCF1; AIM31; LELG_03864; Respiratory supercomplex factor 1, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Target Names
RCF1
Target Protein Sequence
MTQRLPSSMSFGEEEEPDVLQKMMQKCKEQPFVPIGSLLTAGAVILAARSMKRGEKLKTQ KYFRYRIGFQLATLIALVAGGVTLGQSSLEQKKTKEDQLREKAKLREKLWVEELERRDAI IQARKQRLEESKKELRDLAKQGFEDEREVDQGKK
Uniprot No.

Target Background

Function

Cytochrome c oxidase subunit involved in the assembly of respiratory supercomplexes.

Database Links
Protein Families
RCF1 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does L. elongisporus AIM31/RCF1 compare to homologous proteins in other fungal species?

  • Sequence length: The 154-amino acid length in L. elongisporus differs slightly from homologs in other species

  • Binding affinity: Differential interaction strengths with cytochrome bc1 and COX complexes

  • Functional redundancy: Variable overlap with RCF2 (AIM38) protein function

In Saccharomyces cerevisiae, the Aim31/Rcf1 protein functions as a component of the cytochrome bc1-COX supercomplex, binding to both the cytochrome bc1 and COX enzyme domains, with a particularly close association with the Cox3 protein . These interactions appear to be broadly conserved across fungal species, suggesting evolutionary preservation of this critical respiratory chain function.

What experimental approaches can differentiate L. elongisporus from related Candida species when studying AIM31/RCF1?

When isolating L. elongisporus for AIM31/RCF1 studies, researchers should implement a multi-faceted identification approach:

  • Morphological examination: L. elongisporus predominantly exhibits elongated cell forms, distinct from the typical budding yeast morphology of Candida species. Scanning Electron Microscopy (SEM) can clearly visualize these differences .

  • Sugar utilization testing: The in-house Arabinose (Loddy) Test leverages L. elongisporus' unique inability to utilize L-Arabinose, effectively differentiating it from Candida species like C. albicans, C. tropicalis, and C. parapsilosis, all of which can metabolize this sugar .

  • Molecular identification:

    • ITS-DNA sequencing of the internal transcribed spacer regions

    • PCR amplification of the D1/D2 domains of ribosomal DNA

    • MALDI-TOF MS profiling

  • Genome analysis: Identification based on the characteristic 15-16 Mb genome size and placement within the CTG clade, where the CUG codon translates as serine instead of leucine .

These differentiation techniques ensure accurate species identification when isolating L. elongisporus for subsequent AIM31/RCF1 protein studies.

What are the optimal conditions for recombinant expression of L. elongisporus AIM31/RCF1 protein?

For efficient recombinant expression of L. elongisporus AIM31/RCF1:

  • Expression system: E. coli has proven effective for producing full-length protein (amino acids 1-154) with N-terminal His-tag fusion .

  • Vector selection: pET-series vectors with T7 promoter systems provide tight regulation and high expression levels.

  • Induction parameters:

    • IPTG concentration: 0.5-1.0 mM

    • Induction temperature: 18-25°C (lower temperatures increase soluble protein yield)

    • Induction duration: 16-20 hours

  • Media optimization:

    • LB or 2xYT media supplemented with appropriate antibiotics

    • Addition of 0.2% glucose can reduce basal expression

    • Trace metal supplementation may improve protein folding

  • Host strain considerations:

    • BL21(DE3) derivatives show good expression

    • Rosetta or CodonPlus strains account for codon bias

    • C41/C43 strains may improve membrane protein expression

Post-expression analysis using SDS-PAGE should confirm protein production with >90% purity achievable through subsequent purification steps .

What purification strategy yields the highest purity and activity for recombinant L. elongisporus AIM31/RCF1?

A multi-step purification approach ensures optimal purity while maintaining functional integrity:

  • Initial capture:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin

    • Binding buffer: 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole

    • Elution with 250-300 mM imidazole gradient

  • Intermediate purification:

    • Ion exchange chromatography (typically anion exchange)

    • Buffer: 20 mM Tris-HCl pH 8.0, with NaCl gradient from 50-500 mM

  • Polishing step:

    • Size exclusion chromatography

    • Buffer: PBS-based buffer with 6% trehalose, pH 8.0

  • Quality control criteria:

    • SDS-PAGE analysis (>90% purity)

    • Western blot confirmation

    • Mass spectrometry verification

    • Functional assays for supercomplex association

  • Storage recommendations:

    • Store at -20°C/-80°C

    • Reconstitute in deionized water to 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration) for long-term storage

    • Avoid repeated freeze-thaw cycles

This protocol typically yields 2-5 mg of purified protein per liter of bacterial culture with preserved structural integrity.

How can researchers effectively analyze the interaction of AIM31/RCF1 with respiratory chain complexes?

Several complementary approaches can elucidate AIM31/RCF1 interactions with respiratory chain components:

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Solubilize mitochondria with mild detergents (digitonin)

    • Identify supercomplex associations by migration patterns

    • Detect AIM31/RCF1 by immunoblotting against the protein tag or using specific antibodies

  • Affinity purification coupled with mass spectrometry:

    • Use His-tagged AIM31/RCF1 as bait

    • Cross-link protein complexes if interactions are transient

    • Identify interacting partners by LC-MS/MS analysis

  • Co-immunoprecipitation studies:

    • Precipitate with antibodies against AIM31/RCF1 or suspected partners

    • Western blot for interacting proteins

    • Compare wild-type and mutant forms to identify critical binding domains

  • Proximity labeling approaches:

    • BioID or APEX2 fusion constructs

    • Identify neighboring proteins in the intact mitochondrial environment

  • Surface Plasmon Resonance (SPR) or Microscale Thermophoresis (MST):

    • Quantify binding affinities with purified components

    • Determine association/dissociation kinetics

    • Test effects of mutations on binding properties

The most informative approach combines in vivo techniques like BN-PAGE with in vitro binding assays to comprehensively characterize interaction dynamics .

What methodologies can assess the impact of AIM31/RCF1 mutations on respiratory function?

To evaluate how AIM31/RCF1 mutations affect respiratory function:

  • Oxygen consumption measurement:

    • Clark-type electrode or Seahorse XF analyzer

    • Compare basal respiration, maximal respiratory capacity, and spare capacity

    • Assess substrate-specific respiration (NADH, succinate, etc.)

  • Respiratory chain complex activity assays:

    • Spectrophotometric measurement of individual complex activities

    • Focus on Complex IV (cytochrome c oxidase) activity, which is particularly affected by AIM31/RCF1 dysfunction

    • Monitor activity in isolated mitochondria from wild-type and mutant strains

  • Supercomplex stability assessment:

    • BN-PAGE analysis of digitonin-solubilized mitochondria

    • Quantify supercomplex/individual complex ratios

    • Test stability under stress conditions (temperature, detergent concentration)

  • Mitochondrial membrane potential measurement:

    • Fluorescent dyes (TMRM, JC-1)

    • Flow cytometry or confocal microscopy quantification

    • Correlate with ROS production and ATP generation

  • Genetic complementation studies:

    • Express wild-type and mutant AIM31/RCF1 variants in knockout backgrounds

    • Assess rescue of respiratory defects

    • Test cross-species complementation with S. cerevisiae Aim31/Rcf1

These approaches provide a comprehensive evaluation of how specific AIM31/RCF1 mutations impact not only protein interaction but downstream respiratory function, linking molecular alterations to cellular physiology.

How does the function of AIM31/RCF1 in L. elongisporus compare with its homologs in model organisms like S. cerevisiae?

Comparative functional analysis reveals both conserved and divergent aspects of AIM31/RCF1 function:

AspectL. elongisporus AIM31/RCF1S. cerevisiae Aim31/Rcf1Significance
Supercomplex AssociationAssociates with cytochrome bc1-COX supercomplexComponent of cytochrome bc1-COX supercomplexConserved role in respiratory chain organization
Interaction with Cox3Present but with potential structural variationsClose physical relationship with Cox3 proteinCritical for COX complex stability
Functional redundancyLikely complementary with Rcf2-like proteinsShares overlapping function with Aim38/Rcf2Evolutionary conservation of backup mechanisms
Impact on COX assemblyModerately affects assemblyLoss with Rcf2 significantly impacts COX activity and peripheral subunit assemblySpecies-specific dependence on these factors
Adaptation to oxygen levelsLikely responsive to hypoxia (Hig1 family)Member of hypoxia-induced gene 1 protein familyConserved oxygen-responsive regulation

The core function of stabilizing respiratory supercomplexes appears conserved, but with species-specific adaptations likely reflecting the different ecological niches and metabolic requirements of these fungi. The presence of AIM31/RCF1 in pathogenic yeast like L. elongisporus suggests potential roles in virulence and stress adaptation that diverge from non-pathogenic species like S. cerevisiae .

What techniques can effectively compare mitochondrial inheritance patterns between different fungal species expressing AIM31/RCF1?

To investigate comparative mitochondrial inheritance patterns:

  • Fluorescent labeling of mitochondrial DNA:

    • MitoTracker dyes combined with DNA-specific fluorophores

    • Time-lapse microscopy to track inheritance during cell division

    • Quantification of mtDNA distribution asymmetry

  • Genetic approaches:

    • Create reporter constructs with species-specific mtDNA regulatory elements

    • Generate heteroplasmic strains carrying mixed mtDNA populations

    • Track segregation patterns using selective markers

  • Biochemical isolation and quantification:

    • Isolate mitochondria from parent and daughter cells

    • Quantify mtDNA copy number by qPCR

    • Assess protein levels of inheritance factors including AIM31/RCF1

  • Cross-species genetic complementation:

    • Express L. elongisporus AIM31/RCF1 in S. cerevisiae aim31Δ strains

    • Test rescue of mitochondrial inheritance defects

    • Identify species-specific functional domains through chimeric proteins

  • Evolutionary rate analysis:

    • Compare sequence conservation rates across Hig1 family members

    • Identify regions under positive or purifying selection

    • Correlate with functional domains and interaction sites

These approaches can reveal how AIM31/RCF1's role in mitochondrial inheritance has evolved across fungal lineages and may identify species-specific adaptations in pathogenic versus non-pathogenic fungi.

How might researchers engineer AIM31/RCF1 variants to modify mitochondrial function in L. elongisporus?

Strategic engineering of AIM31/RCF1 could modify mitochondrial function through:

  • Domain-specific mutations:

    • Transmembrane domain alterations to affect membrane anchoring

    • Modify interaction surfaces with Cox3 or cytochrome bc1

    • Engineer phosphorylation sites to regulate activity

  • Protein fusion approaches:

    • Create chimeric proteins with domains from other species

    • Introduce regulatory domains (e.g., light-sensitive, drug-responsive)

    • Add proximity labeling domains to capture transient interactions

  • Expression level modifications:

    • Design inducible promoter systems specific for L. elongisporus

    • Create dominant-negative variants to competitively inhibit function

    • Establish heterologous expression systems for controlled studies

  • CRISPR-Cas9 genome editing:

    • Precise modification of the endogenous AIM31/RCF1 gene

    • Create point mutations to test specific functional hypotheses

    • Develop conditional knockouts for temporal studies

  • Mitochondrial targeting sequence modifications:

    • Alter import efficiency to modulate mitochondrial protein levels

    • Test effects of mistargeting to other mitochondrial compartments

    • Create reporter fusions to monitor localization patterns

These approaches could lead to fundamental insights about respiratory chain assembly and function, while potentially offering tools to modulate virulence in this emerging pathogenic yeast.

What research protocols can explore the relationship between AIM31/RCF1 function and L. elongisporus pathogenicity?

To investigate AIM31/RCF1's role in pathogenicity:

  • Infection models with AIM31/RCF1 variants:

    • Gene knockout and complementation studies

    • Test virulence in appropriate host systems

    • Monitor infection progression with bioluminescent imaging

  • Stress response characterization:

    • Assess tolerance to oxidative, osmotic, and thermal stress

    • Measure respiratory adaptation under host-mimicking conditions

    • Quantify metabolic flexibility during infection

  • Host-pathogen interaction studies:

    • Co-culture with immune cells to assess phagocytosis resistance

    • Measure ROS production and detoxification capacity

    • Analyze biofilm formation and antifungal resistance

  • Transcriptomic and proteomic profiling:

    • Compare wildtype and AIM31/RCF1-modified strains during infection

    • Identify co-regulated pathways linking respiration to virulence

    • Perform temporal analysis to capture adaptation dynamics

  • Metabolic analysis:

    • Measure ATP production during infection

    • Profile changes in carbon source utilization

    • Assess mitochondrial function under hypoxic conditions typical during infection

These approaches could reveal whether the unique characteristics of L. elongisporus, including its relative lower virulence compared to other CTG clade members like C. albicans or C. parapsilosis , correlate with AIM31/RCF1-mediated respiratory adaptation.

How does understanding AIM31/RCF1 function inform clinical approaches to L. elongisporus infections?

Understanding AIM31/RCF1 function has several clinical implications:

  • Diagnostic development:

    • AIM31/RCF1 sequence variations could serve as molecular markers for rapid identification

    • Respiratory phenotyping may complement current diagnostic tests like the Loddy Test

    • Expression patterns could indicate strain virulence potential

  • Treatment strategy refinement:

    • As L. elongisporus remains susceptible to conventional antifungal agents (unlike some drug-resistant Candida species), understanding its respiratory adaptability could help maintain this therapeutic advantage

    • Mitochondrial function inhibitors might be explored as adjunctive therapy

    • Patient-specific factors affecting mitochondrial function could inform personalized approaches

  • Risk assessment improvement:

    • Data shows L. elongisporus infections predominantly affect adults with specific risk factors including:

      • Surgery and trauma (reported in 6 patients)

      • Cardiovascular and cerebrovascular diseases (6 patients)

      • Central venous catheterization (3 patients)

      • Various others including diabetes, cancer, and broad-spectrum antibiotic use

    • Understanding how AIM31/RCF1 function relates to these clinical scenarios could improve risk stratification

  • Monitoring treatment response:

    • Changes in respiratory function could serve as biomarkers for therapeutic efficacy

    • Metabolic signatures linked to AIM31/RCF1 function might predict relapse

The mechanistic understanding of AIM31/RCF1's role in mitochondrial function provides a scientific foundation for clinical advances in managing this emerging pathogen.

What methodologies connect AIM31/RCF1 function to mitochondrial disease models?

Several approaches can link AIM31/RCF1 function to broader mitochondrial disease understanding:

  • Comparative analysis of mitochondrial inheritance:

    • Human mitochondrial DNA is maternally inherited, with each mitochondrion containing 2-10 mtDNA copies

    • Compare inheritance mechanisms between human cells and L. elongisporus models

    • Analyze how AIM31/RCF1 homologs affect mtDNA bottleneck effects in both systems

  • Heterologous expression studies:

    • Express human Hig1 family proteins in L. elongisporus AIM31/RCF1 knockouts

    • Test functional complementation and respiratory complex rescue

    • Identify conserved mechanisms across species boundaries

  • Disease-associated mutation modeling:

    • Introduce mutations corresponding to human mitochondrial disease variants

    • Assess effects on supercomplex stability and respiratory function

    • Use as platform for therapeutic compound screening

  • Heteroplasmy dynamics investigation:

    • Create L. elongisporus strains with mixed wild-type and mutant mtDNA

    • Track segregation patterns influenced by AIM31/RCF1 activity

    • Model inheritance of pathogenic mtDNA mutations seen in human diseases

  • Aging and mitochondrial dysfunction studies:

    • Examine AIM31/RCF1 function throughout L. elongisporus lifespan

    • Correlate with patterns of mitochondrial decline in aging human cells

    • Test interventions targeting supercomplex stability

These approaches leverage the experimentally tractable L. elongisporus system to inform understanding of fundamental mitochondrial biology relevant to human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.