Recombinant Lodderomyces elongisporus Altered inheritance of mitochondria protein 36, mitochondrial (AIM36)

What is Lodderomyces elongisporus and why is it significant in research?

Lodderomyces elongisporus is a fungal species that has emerged as an important opportunistic pathogen capable of causing bloodstream infections, particularly in neonates. Initially misidentified as Candida parapsilosis due to physiological similarities and phylogenetic relatedness, L. elongisporus has been isolated from diverse sources including soft drinks, juice concentrates, natural cocoa fermentations, soil, infected fingernails, bloodstream infections, and baby cream products . Its significance in research stems from its ability to cause fungemia outbreaks, its often-overlooked presence in clinical settings, and its unique characteristics among pathogenic yeasts, including the ability to form ascospores—a distinctive feature compared to Candida species . It is classified as an RG-1 (Risk Group 1) organism, suggesting relatively low risk to healthy individuals .

What is the structure and function of AIM36 protein in L. elongisporus?

The Altered inheritance of mitochondria protein 36 (AIM36) in L. elongisporus is a mitochondrial protein consisting of 287 amino acids, with the mature protein spanning positions 15-287 . The protein sequence includes multiple functional domains involved in mitochondrial inheritance and function. Based on its amino acid composition and structural predictions, AIM36 appears to play a crucial role in mitochondrial membrane organization and inheritance during cell division.

The full amino acid sequence of the mature protein (positions 15-287) is: ETFLHSPRAKLVQPYLFNSQRQYVIVHKDLQKAKKEPRIRYILYMIALSWAAIFFVSSKVDKKKPMQSMTEREFQEYEKQTGIKRRHKLIHSDQNSKYKFYVIPYIYNNEQIEKIEQSLAKSDPNRKNVVIDPAKLVLEEKEDEGAKYSALLNDLDAMKKPYPPGLITAIIKQHINLLINTREGTFDTNYIIKNYPQTTGEAIKFENDIGDISKCLIMHYDMLNELPQQLPEEKVRNIRN
VEGYFDSVNKAQTMVSKFDIMDEKFEEIILEDL .

How is L. elongisporus identified and distinguished from similar species?

Identifying L. elongisporus accurately requires multiple approaches due to its frequent misidentification as C. parapsilosis using conventional biochemical methods:

Conventional methods:

• On CHROMagar Candida medium, L. elongisporus exhibits distinctive green/blue colonies after 48 hours of incubation at 37°C, which can provide an initial clue to its identity .

• Microscopic examination reveals ellipsoid to elongate budding blastoconidia (2.6-6.3 × 4-7.4 μm) with occasional spherical forms .

• Dalmau plate culture shows abundant, much-branched pseudohyphae .

Definitive identification methods:

• Matrix-assisted laser desorption ionization–time of flight mass spectrometry (MALDI-TOF MS) provides reliable species-level identification .

• Internal transcribed spacer (ITS) sequencing of ribosomal DNA is considered the gold standard for confirmation .

• D1/D2 sequence analysis has been crucial in distinguishing L. elongisporus from atypical C. parapsilosis isolates .

The distinctive ascospore formation capability is a key differentiating feature: L. elongisporus forms unconjugated, persistent asci that produce one (rarely two) long-ellipsoid ascospores, observable on V8 agar after 7-10 days at 25°C .

What are the optimal conditions for expression and purification of recombinant L. elongisporus AIM36 protein?

Based on established protocols for the commercial production of recombinant L. elongisporus AIM36, the following methodological approach is recommended:

Expression system:

• E. coli is the preferred heterologous expression system, particularly for producing N-terminal His-tagged fusion proteins .

• The optimal construct should include the mature protein sequence (amino acids 15-287), without the mitochondrial targeting sequence.

Culture conditions:

• Use standard LB medium supplemented with appropriate antibiotics based on the expression vector.

• Induce protein expression at mid-log phase (OD600 ≈0.6) with IPTG (typically 0.5-1.0 mM).

• Lower induction temperatures (16-25°C) often improve solubility compared to standard 37°C induction.

Purification strategy:

• Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged proteins.

• Buffer optimization is crucial: standard Tris/PBS-based buffers (pH 8.0) with 6% trehalose have proven effective for stability .

• Consider size exclusion chromatography as a polishing step to achieve >90% purity.

Storage recommendations:

• Lyophilization provides the best long-term stability.

• For reconstituted protein, maintain in deionized sterile water at a concentration of 0.1-1.0 mg/mL.

• Add glycerol to a final concentration of 30-50% for aliquots stored at -20°C/-80°C to prevent freeze-thaw damage .

How can researchers effectively design experiments to study AIM36 function in mitochondrial inheritance?

Knockout/knockdown approaches:

• CRISPR-Cas9 system targeting the AIM36 gene can generate knockout strains.

• RNA interference (RNAi) or antisense oligonucleotides can be used for transient knockdown studies.

• Complementation assays with wild-type AIM36 should confirm phenotypes are specifically due to AIM36 disruption.

Subcellular localization:

• Fluorescent protein tagging (GFP/mCherry) at either N- or C-terminus, ensuring the tag doesn't interfere with targeting signals.

• Mitochondrial co-localization studies using established markers like MitoTracker.

• Immunogold electron microscopy for precise sub-mitochondrial localization.

Functional assays:

• Mitochondrial inheritance tracking using time-lapse microscopy in wild-type versus AIM36-deficient strains.

• Quantitative assessment of mitochondrial morphology, distribution, and membrane potential.

• Measurement of mitochondrial DNA copy number and distribution during cell division.

• Evaluation of respiratory capacity and ATP production.

Protein interaction studies:

• Co-immunoprecipitation to identify binding partners.

• Proximity labeling approaches (BioID or APEX) to map the protein interaction network.

• Yeast two-hybrid screening to identify specific interaction domains.

How does AIM36 in L. elongisporus compare with homologous proteins in related pathogenic fungi?

Phylogenetic analysis:
L. elongisporus AIM36 shares structural and functional similarities with homologous proteins in other pathogenic fungi, particularly within the Candida clade. Comparative genomic approaches reveal that while the core functional domains are conserved, there are species-specific adaptations that may contribute to pathogenicity differences.

Structural comparisons:
The AIM36 protein in L. elongisporus (UniProt ID: A5DTQ6) contains conserved domains found in mitochondrial proteins associated with membrane organization. Homology modeling and structural alignment with related proteins from C. albicans and C. parapsilosis reveal conserved secondary structures but variations in surface-exposed regions that may affect protein-protein interactions.

Functional divergence:
Despite sharing the core function of mitochondrial inheritance, experimental evidence suggests species-specific roles for AIM36 homologs. These differences may contribute to the varying degrees of virulence and stress resistance observed among these pathogenic fungi. In particular, differences in mitochondrial dynamics during host cell interaction could influence pathogenicity mechanisms.

What is the relationship between L. elongisporus AIM36 function and antifungal resistance mechanisms?

While direct evidence linking AIM36 to antifungal resistance is limited, several indirect connections merit investigation:

Mitochondrial function and azole resistance:
Azole antifungals target ergosterol biosynthesis, a process dependent on mitochondrial function. L. elongisporus clinical isolates generally show low MICs for azoles (fluconazole: 0.25-1 mg/L; voriconazole: <0.03-0.06 mg/L; itraconazole: 0.03-0.25 mg/L) . Investigation of AIM36's potential role in maintaining mitochondrial function under azole stress could reveal new resistance mechanisms.

Disinfectant resistance correlation:
Some L. elongisporus clinical isolates show elevated resistance to sodium hypochlorite (2-4% MICs compared to the standard 1% concentration used in clinical practice) . This resistance correlates with genomic changes, including SNPs in resistance-related genes. Studies examining whether AIM36 mutations or expression changes contribute to this disinfectant resistance would be valuable.

Stress response pathways:
AIM36's role in mitochondrial function may influence cellular stress responses that overlap with antifungal resistance mechanisms. Comparative transcriptomic and proteomic analyses of wild-type versus AIM36-mutant strains under antifungal pressure could elucidate these connections.

How can phenotypic divergence in clinical L. elongisporus isolates be linked to genomic variations affecting mitochondrial proteins?

Recent genomic analyses of L. elongisporus isolates from a fungemia outbreak revealed significant genomic diversity among clinical strains and between clinical and environmental isolates . This phenotypic divergence can be methodically investigated through:

Whole-genome sequencing approaches:

• Compare clinical isolates from different patients and sequential isolates from the same patient.

• Analyze SNPs specifically in genes encoding mitochondrial proteins, including AIM36.

• Identify loss of heterozygosity (LOH) events affecting mitochondrial function genes.

Correlation of genomic and phenotypic data:

• Map mitochondrial gene variations to phenotypic differences in growth rate, virulence, and antifungal susceptibility.

• Assess ploidy variations (diploid vs. aneuploid states) and their impact on mitochondrial gene expression .

• Evaluate the relationship between ascospore formation capacity and mitochondrial gene variations.

Experimental validation:

• Generate isogenic strains differing only in specific AIM36 variants.

• Compare mitochondrial morphology, inheritance patterns, and function.

• Assess virulence in appropriate infection models to establish causality between specific genetic variants and pathogenicity.

What are the optimal protocols for studying L. elongisporus pathogenicity and its relation to mitochondrial function?

Infection models:

• Neonatal mouse model: Particularly relevant given L. elongisporus's association with neonatal bloodstream infections .

• Galleria mellonella larvae model: Provides a cost-effective alternative for initial virulence screening.

• Ex vivo blood infection model: Useful for studying interactions with blood components and immune cells.

Virulence factor assessment:

• Biofilm formation assay: Quantify using crystal violet staining and confocal microscopy.

• Adherence to epithelial cells: Measured using fluorescently labeled fungi and flow cytometry.

• Secreted hydrolytic enzyme activity: Protease, phospholipase, and hemolytic activity assays.

Mitochondrial function evaluation:

• Oxygen consumption measurement using respirometry.

• Mitochondrial membrane potential assessment using fluorescent dyes (JC-1, TMRM).

• ROS production quantification during host-pathogen interaction.

Host response analysis:

• Cytokine profiling during infection with wild-type versus AIM36-mutant strains.

• Neutrophil extracellular trap (NET) formation quantification.

• Transcriptomic analysis of host cells infected with different fungal strains.

How can researchers effectively differentiate between pathogenic and non-pathogenic L. elongisporus strains based on mitochondrial protein profiles?

Comparative proteomics approach:

• Isolate mitochondria from clinical (cluster I) and environmental (cluster II) L. elongisporus strains .

• Perform quantitative proteomics using iTRAQ or TMT labeling.

• Analyze differential protein expression, focusing on AIM36 and related mitochondrial proteins.

• Validate findings with targeted Western blot analysis.

Functional mitochondrial assays:

• Compare respiratory capacity between strain clusters.

• Assess mitochondrial morphology and dynamics during stress conditions.

• Measure ATP production and energy metabolism differences.

• Evaluate mitochondrial response to host immune factors.

Genetic marker identification:

• Develop PCR-based assays targeting mitochondrial gene variants unique to pathogenic strains.

• Create a diagnostic panel of SNPs in mitochondrial proteins, including AIM36.

• Validate markers across diverse clinical and environmental isolates.

How does the susceptibility profile of L. elongisporus compare to other fungal pathogens, and what role might mitochondrial proteins play?

L. elongisporus exhibits a distinct antifungal susceptibility profile compared to related species. Key findings include:

Antifungal susceptibility data:

Mitochondrial protein involvement:
Mitochondrial proteins, including AIM36, may influence antifungal susceptibility through:

• Maintenance of membrane integrity and composition, affecting drug penetration.

• Modulation of energy metabolism required for efflux pump activity.

• Involvement in stress response pathways activated by antifungal agents.

• Contribution to cellular redox balance, which can impact drug efficacy.

Research approaches to explore this connection:

• Targeted gene disruption of AIM36 followed by antifungal susceptibility testing.

• Transcriptomic analysis of mitochondrial gene expression following antifungal exposure.

• Comparative studies between clinical isolates with varying susceptibility profiles, focusing on mitochondrial proteome differences.

What methodological approaches can be used to investigate the relationship between sodium hypochlorite resistance and mitochondrial function in L. elongisporus?

The observation that clinical and hospital environment L. elongisporus strains show elevated resistance to sodium hypochlorite (2-4% MIC) compared to environmental fruit isolates (0.06-0.5% MIC) presents an intriguing research question. To investigate the potential role of mitochondrial function in this resistance, the following methods are recommended:

Experimental approaches:

• Mitochondrial response to oxidative stress:

  • Measure ROS production and mitochondrial membrane potential following sodium hypochlorite exposure.

  • Compare mitochondrial morphology changes in resistant versus susceptible strains.

  • Assess mitochondrial DNA damage and repair mechanisms after disinfectant exposure.

• AIM36 expression and localization studies:

  • Quantify AIM36 expression levels before and after sodium hypochlorite treatment.

  • Analyze AIM36 protein localization changes in response to disinfectant stress.

  • Perform AIM36 knockdown/overexpression studies to assess direct impact on disinfectant resistance.

• Comparative genomics and transcriptomics:

  • Analyze the 119 nonsynonymous SNPs identified in triazole resistance-related genes for potential overlap with mitochondrial function.

  • Perform RNA-seq to identify differentially expressed mitochondrial genes in resistant versus susceptible strains.

  • Conduct targeted sequencing of mitochondrial DNA to identify strain-specific variations.

• Biochemical assessment:

  • Measure detoxification enzyme activities (catalase, superoxide dismutase) in mitochondria.

  • Assess mitochondrial respiration before and after sodium hypochlorite exposure.

  • Investigate changes in mitochondrial protein oxidation levels in resistant strains.

How does genetic recombination and ploidy variation in L. elongisporus affect mitochondrial inheritance and function?

L. elongisporus exhibits significant genetic diversity, recombination, and ploidy variation, which can impact mitochondrial function and inheritance. Research findings indicate:

Ploidy variations:

• Most L. elongisporus strains are diploid, similar to C. albicans .

• Some environmental isolates (particularly those from hospital surfaces) show aneuploidy, with DNA content between haploid and diploid levels .

• These ploidy variations likely influence mitochondrial inheritance mechanisms.

Recombination impacts:

• Genomic analyses reveal evidence of recombination in L. elongisporus populations .

• This genetic exchange may facilitate the transfer of mitochondrial function genes, including variants of AIM36.

• Recombination could contribute to the emergence of novel phenotypes related to mitochondrial function and pathogenicity.

Research methodologies to explore these connections:

• Whole-genome sequencing of isolates with different ploidy levels.

• Mitochondrial DNA copy number analysis across strain collections.

• Tracking mitochondrial inheritance patterns in mating experiments.

• Analysis of nuclear-mitochondrial genomic interactions.

• Assessment of AIM36 expression and function across strains with different ploidy levels.

What insights can comparative genomics provide about the evolution of AIM36 function across fungal species?

Evolutionary conservation analysis:
The AIM36 protein (UniProt ID: A5DTQ6) in L. elongisporus represents a conserved mitochondrial function protein with homologs across the fungal kingdom. Comparative genomics approaches can reveal:

• Evolutionary trajectories of AIM36 across major fungal lineages.

• Selection pressures acting on different protein domains.

• Correlation between AIM36 sequence variation and species-specific mitochondrial functions.

Methodological approaches:

• Phylogenetic analysis of AIM36 sequences from diverse fungi, including pathogenic and non-pathogenic species.

• Calculation of Ka/Ks ratios to identify regions under positive or purifying selection.

• Ancestral sequence reconstruction to map the evolution of key functional domains.

• Structural modeling to predict the impact of species-specific variations on protein function.

• Complementation studies testing AIM36 orthologs from different species in L. elongisporus.

Expected insights: This comparative approach can reveal whether AIM36 adaptations correlate with the evolution of pathogenicity, host specificity, or environmental adaptation in different fungal lineages, providing a broader context for understanding the role of mitochondrial proteins in fungal biology and virulence.