Recombinant Lodderomyces elongisporus Golgi to ER traffic protein 1 (GET1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Lodderomyces elongisporus Golgi to ER traffic protein 1 (GET1) is a protein component involved in the Get pathway, specifically in the insertion of tail-anchored (TA) proteins into the endoplasmic reticulum (ER) membrane . Lodderomyces elongisporus GET1, with a His-tag, has a molecular weight of approximately 22.9 kDa. The protein comprises 204 amino acids and is expressed in E. coli .

Function and Mechanism

GET1 functions as a subunit of the membrane insertase complex, facilitating the insertion of TA proteins into the ER membrane . TA proteins have a hydrophobic C-terminal domain that anchors them to the lipid bilayer . The Get pathway involves several proteins, including Get3, which captures client proteins and interacts with Get1 and Get2, membrane factors that enable the insertion of the C-terminal tail of substrates into the ER membrane .

Homologs and Interactions

Arabidopsis has homologs of the main components of the GET pathway, including Get1 (At4g16444), Get2, Get3, Get4, Get5, Sgt2, and Bag6 . Arabidopsis GET1 interacts with GET3 in vitro, suggesting a functional relationship in TA protein delivery .

The following table summarizes the Arabidopsis homologs of GET system components in yeast and mammals :

Yeast GeneMammalian GeneArabidopsis GenePredicted Function
Get1WRBAt4g16444Subunit of the membrane insertase complex
Get2CAMLSubunit of the membrane insertase complex
Get3TRC40At1g01910TA substrate targeting factor
Get4TRC35At5g63220Subunit of the pretargeting complex
Get5Ubl4AAt1g55060Subunit of the pretargeting complex
Sgt2SGTAAt4g08320Subunit of the pretargeting complex
Bag6Bag6Subunit of the pretargeting complex

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment based on your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize development of your specified tag.
Synonyms
GET1; LELG_01195; Golgi to ER traffic protein 1; Guided entry of tail-anchored proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Target Names
GET1
Target Protein Sequence
MLTLDIDPYTILVTSFLILAIQKLVTVIGKQKIQLYIWQIYTKYLSHSQSIKQFNLKQKE IKDLTKQQKLISAQDEYAKWTKINRALDKLKLEVQELNETIAGEKTRIDSITKLAITLIL TLPIWFLRIFCRKTALLYIRKGILPAYLEWWLALPFFKSGTIGLTCWMFVVNSVLSNLIF LISFPFTQKVERPIKPKNEQKTES
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET2, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of resident ER proteins containing a C-terminal H-D-E-L retention signal from the Golgi apparatus back to the ER.

Database Links
Protein Families
WRB/GET1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is GET1 and what is its functional role in Lodderomyces elongisporus?

GET1 (Golgi to ER traffic protein 1) in Lodderomyces elongisporus functions as a key component in the guided entry of tail-anchored proteins pathway. Based on its amino acid sequence and homology to other fungal species, it plays a critical role in the insertion of tail-anchored membrane proteins into the endoplasmic reticulum (ER). The protein contains transmembrane domains that anchor it within the ER membrane, allowing it to form complexes with other trafficking components .

L. elongisporus GET1 participates in the retrograde transport mechanism from the Golgi to the ER, which is essential for maintaining cellular homeostasis and proper protein localization. The protein's full amino acid sequence (MLTLDIDPYTI LVTSFLILAI QKLVTVIGKQ KIQLYIWQIY TKYLSHSQSI KQFNLKQKEI KDLTKQQKLI SAQDEYAKWT KINRALDKLK LEVQELNETI AGEKTRIDSI TKLAITLILT LPIWFLRIFC RKTALLYIRK GILPAYLEWW LALPFFKSGT IGLTCWMFVV NSVLSNLIFL ISFPFTQKVE RPIKPKNEQK TES) reveals structural features consistent with its membrane-associated function .

How does GET1 in L. elongisporus compare structurally to homologous proteins in other fungi?

L. elongisporus GET1 shows significant structural similarities to homologous proteins in other fungal species, particularly those in the Candida clade. Sequence alignment studies reveal conserved domains associated with membrane integration and protein trafficking functions. The protein shares functional domains with the COPII complex components, which are responsible for ER to Golgi transport .

While L. elongisporus GET1 maintains core structural elements found across fungal species, it does possess unique sequence variations that may reflect adaptations specific to its ecological niche. These adaptations could be related to the organism's pathogenicity or its ability to survive in diverse environments, including clinical settings and fruit surfaces .

What experimental approaches are recommended for initial characterization of GET1 function?

For initial characterization of GET1 function in L. elongisporus, researchers should consider:

  • Subcellular localization studies: Using fluorescently tagged GET1 constructs to confirm its ER localization and potential co-localization with other trafficking components.

  • Deletion/knockdown experiments: Generating GET1-deficient strains to observe phenotypic effects on protein trafficking, with particular attention to tail-anchored membrane proteins.

  • Protein-protein interaction assays: Employing co-immunoprecipitation, yeast two-hybrid, or proximity labeling techniques to identify interaction partners. Pay particular attention to interactions with GET2 and GET3, which form functional complexes with GET1 in other fungal species.

  • Comparative genomics: Analyzing GET1 sequence conservation across clinical and environmental isolates of L. elongisporus to identify potentially functionally important regions, similar to the genome comparisons performed in the NICU outbreak investigation .

What are the optimal conditions for expressing recombinant L. elongisporus GET1?

Expression of recombinant L. elongisporus GET1 requires careful optimization due to its hydrophobic transmembrane domains. Based on protocols for similar membrane proteins:

  • Expression system selection: For full-length GET1, membrane-capable expression systems such as Pichia pastoris or mammalian cells are recommended over standard E. coli systems. If using E. coli, consider specialized strains (C41/C43) designed for membrane protein expression.

  • Temperature optimization: Lower induction temperatures (16-20°C) generally improve proper folding of membrane proteins.

  • Detergent screening: A panel of detergents (DDM, LDAO, Fos-choline) should be tested for optimal solubilization during purification.

  • Construct design: Consider expressing soluble domains separately if full-length protein expression is problematic. The GET1 sequence (stored in 50% glycerol, Tris-based buffer) shows distinct hydrophobic regions that may complicate expression .

  • Codon optimization: Adapt codons to the expression host to improve protein yield.

What purification strategy yields the highest purity and activity for recombinant GET1?

For optimal purification of L. elongisporus GET1, a multi-step approach is recommended:

  • Affinity chromatography: Using a suitable tag (His6, FLAG, or Strep) positioned away from functional domains. The tag type should be determined during the production process for optimal results .

  • Size exclusion chromatography: To separate monomeric from aggregated protein and remove contaminants.

  • Buffer optimization: Screening different buffer compositions, focusing on:

    • pH range (7.0-8.0)

    • Salt concentration (150-300 mM NaCl)

    • Glycerol content (10-20% for stability)

    • Detergent concentration (just above CMC)

  • Storage conditions: Store working aliquots at 4°C for up to one week. For extended storage, maintain at -20°C or preferably -80°C. Avoid repeated freeze-thaw cycles as they may compromise protein integrity .

  • Activity verification: After purification, verify GET1 functionality through liposome binding assays or reconstitution with other GET pathway components.

How can researchers validate the functionality of purified recombinant GET1?

Validating GET1 functionality requires multiple complementary approaches:

  • Reconstitution assays: Incorporate purified GET1 into liposomes along with known GET pathway partners to reconstitute tail-anchored protein insertion.

  • Binding studies: Use surface plasmon resonance or microscale thermophoresis to quantify interactions with known binding partners such as GET2 and GET3.

  • Complementation experiments: Express the recombinant protein in GET1-deficient yeast strains to assess functional rescue.

  • Structural integrity assessment: Use circular dichroism to verify proper folding, particularly of alpha-helical transmembrane regions.

  • Mass spectrometry: Confirm the protein's identity and any post-translational modifications that might affect function.

How might GET1 function relate to pathogenicity in L. elongisporus infections?

The relationship between GET1 function and L. elongisporus pathogenicity presents an intriguing research avenue:

  • Protein secretion and virulence: Proper functioning of ER-Golgi trafficking systems, including GET1, is likely essential for the secretion of virulence factors. Analysis of clinical isolates from the NICU outbreak could provide insights into whether GET1 variants correlate with pathogenicity .

  • Stress response adaptation: GET1-mediated protein trafficking may be crucial for L. elongisporus adaptation to host environments, particularly in response to antifungal treatments. The genome analyses of clinical strains revealed significant diversity and recombination that could affect protein trafficking systems .

  • Biofilm formation: Proper membrane protein localization via the GET pathway may contribute to cell surface properties relevant to biofilm formation, a key virulence trait in fungal pathogens.

  • Host-pathogen interaction: GET1 might indirectly influence the expression or localization of surface proteins involved in host cell attachment or immune evasion.

  • Antifungal resistance mechanisms: Given that clinical strains and apple surface strains showed different susceptibility patterns to antifungals, investigating whether GET1-mediated trafficking influences drug resistance would be valuable .

What experimental models are most appropriate for studying GET1 in the context of L. elongisporus pathogenesis?

Several experimental models can be employed to study GET1 in L. elongisporus pathogenesis:

  • Cell culture infection models: Human epithelial or immune cells can be infected with wild-type versus GET1-modified L. elongisporus strains to assess differences in adherence, invasion, and immune response induction.

  • Reconstituted human epithelium: These 3D tissue models provide a more physiologically relevant system to study fungal colonization and invasion.

  • Caenorhabditis elegans infection model: This invertebrate model offers a simple system to assess virulence with genetic tractability.

  • Mouse models of disseminated infection: For advanced studies, comparing wild-type and GET1-mutant strains in murine models can reveal the protein's role in systemic infection, similar to the bloodstream infections observed in neonates .

  • Genomic comparison approach: Analyzing GET1 sequences across clinical isolates with different virulence profiles, similar to the approach used in the NICU outbreak study, can reveal correlations between GET1 variants and pathogenicity .

How does GET1 interact with other protein trafficking machinery in L. elongisporus?

GET1 functions within a complex network of protein trafficking components:

  • GET pathway components: In other fungi, GET1 forms a transmembrane complex with GET2 that serves as a receptor for the GET3-tail-anchored protein complex. Similar interactions likely occur in L. elongisporus based on sequence conservation.

  • Relationship with COPII system: GET1 functions in parallel with the COPII system, which facilitates anterograde transport from ER to Golgi. The COPII complex includes Sec12, Sar1, Sec23/24, and Sec13/31 components that work together for vesicle budding and transport .

  • Integration with Sec proteins: GET1 likely interacts with components of the secretory pathway, including Sec proteins that are integral to vesicular transport. Sec16, for example, functions as a scaffold for COPII assembly and could indirectly influence GET1 function .

  • Relationship with GET3 ATPase cycle: GET1 interaction with GET3 likely triggers ATP release and facilitates tail-anchored protein insertion into the ER membrane through conserved mechanisms.

  • Regulatory interactions: Potential phosphorylation sites in GET1 suggest regulation by kinases that may coordinate its activity with other trafficking components.

What are common pitfalls in GET1 functional assays and how can they be overcome?

Several challenges commonly arise in GET1 functional studies:

  • Protein aggregation: GET1's transmembrane domains make it prone to aggregation.

    • Solution: Screen multiple detergents and incorporate stabilizing agents like glycerol in buffers. Using 50% glycerol in storage buffer can help maintain stability .

  • Low expression yields: Membrane proteins often express poorly.

    • Solution: Optimize codon usage, use strong inducible promoters, and consider fusion tags that enhance solubility.

  • Functional redundancy: Other proteins may compensate for GET1 deficiency in knockout studies.

    • Solution: Consider double knockouts or employ acute depletion methods like auxin-inducible degrons.

  • Verification of interaction specificity: Distinguishing specific from non-specific membrane protein interactions.

    • Solution: Include appropriate controls and validate interactions using multiple complementary techniques.

  • Contamination in fungal cultures: Especially relevant when working with pathogenic species.

    • Solution: Implement rigorous sterile techniques and confirm strain identity using molecular methods, as done in studies of L. elongisporus clinical isolates .

How can researchers resolve contradictory data in GET1 interaction studies?

When faced with contradictory data in GET1 interaction studies:

  • Validate protein quality: Ensure that purified GET1 is properly folded and not aggregated using techniques like size exclusion chromatography multi-angle light scattering (SEC-MALS).

  • Control environmental variables: Subtle differences in buffer conditions, temperature, or protein concentrations can significantly impact membrane protein interactions.

  • Validate with orthogonal methods: Confirm interactions using multiple techniques (e.g., co-IP, FRET, crosslinking, BioID) to build a consensus.

  • Consider detergent effects: Different detergents can preserve or disrupt specific protein-protein interactions. Test a panel of detergents and consider nanodiscs or liposome reconstitution.

  • Sequence verification: Confirm that no mutations have been introduced during cloning by sequencing the entire coding region of your GET1 construct.

What methodological adaptations are needed when comparing GET1 function across different L. elongisporus strains?

When comparing GET1 function across L. elongisporus strains:

  • Sequence verification: First establish whether GET1 sequences differ between strains by PCR amplification and sequencing, as genome diversity has been observed between clinical and environmental isolates .

  • Expression level normalization: Quantify GET1 expression levels in different strains to account for potential differences in baseline expression.

  • Genetic background considerations: Be aware that other genetic differences between strains may indirectly affect GET1 function. The whole-genome analysis approach used in the NICU outbreak study provides a model for understanding strain differences .

  • Growth condition standardization: Maintain identical growth conditions when comparing strains, as environmental factors may influence GET1 expression and function.

  • Recombination analysis: Consider potential recombination events that might affect GET1 and its interacting partners, as recombination was found in all L. elongisporus samples from the outbreak investigation .

How might GET1 be targeted for potential antifungal development?

Targeting GET1 for antifungal development presents several strategic approaches:

  • Structure-based drug design: Once the three-dimensional structure of L. elongisporus GET1 is resolved, rational design of small molecules that disrupt its function could be pursued.

  • Interaction disruptors: Compounds that interfere with GET1-GET2 or GET1-GET3 interactions could compromise the GET pathway and potentially fungal viability.

  • Species-specific targeting: Identifying unique features of L. elongisporus GET1 compared to human homologs could allow for selective targeting with minimal host toxicity.

  • Combination therapies: GET1 inhibitors might sensitize L. elongisporus to existing antifungals like amphotericin B, which was used successfully to treat fungemia in neonates .

  • Susceptibility correlation: Testing whether GET1 variants correlate with the observed differences in antifungal susceptibility between clinical and environmental isolates could reveal its potential role in drug resistance mechanisms .

What omics approaches would provide the most insight into GET1 function in L. elongisporus?

Multiple omics approaches can illuminate GET1 function:

  • Comparative genomics: Analyzing GET1 sequence variations across clinical and environmental isolates of L. elongisporus, similar to the approach used in the NICU outbreak investigation .

  • Transcriptomics: RNA-seq analysis of GET1-deficient versus wild-type strains under various stress conditions to identify affected pathways.

  • Proteomics:

    • Global proteome changes in GET1 mutants

    • Identification of mislocalized tail-anchored proteins

    • Quantitative analysis of membrane proteome alterations

  • Interactomics: Proximity labeling approaches like BioID coupled with mass spectrometry to identify the GET1 protein interaction network.

  • Phenomics: High-throughput phenotypic screening of GET1 mutants under various conditions, including exposure to antifungals used in clinical settings like amphotericin B and fluconazole .

How might environmental adaptations affect GET1 function in different L. elongisporus ecological niches?

L. elongisporus has been isolated from diverse environments including clinical settings and apple surfaces, suggesting adaptation to different niches:

  • Niche-specific expression: GET1 expression levels and regulation may differ between clinical and environmental isolates as an adaptation to different stress conditions. The genomic divergence observed between clinical and apple surface strains suggests potential functional adaptations .

  • Structural adaptations: Sequence variations in GET1 might reflect adaptations to different membrane compositions required in various environments.

  • Functional plasticity: The GET pathway may have expanded or specialized functions in clinical isolates compared to environmental strains, potentially contributing to pathogenicity.

  • Stress response integration: GET1-mediated protein trafficking may be differentially integrated with stress response pathways in different niches, particularly relevant for antifungal resistance development. The marked genomic differences in triazole resistance-related genes between clinical and apple surface strains suggest distinct evolutionary pressures .

  • Recombination effects: The evidence of recombination found in all L. elongisporus samples suggests this mechanism contributes to genetic diversity and adaptation across different environments .

What computational approaches best predict GET1 interactions and functions?

Several computational approaches can effectively predict GET1 interactions and functions:

  • Homology modeling: Using known structures of GET1 homologs to predict L. elongisporus GET1 structure and functional domains.

  • Molecular dynamics simulations: Simulating GET1 behavior in a membrane environment to predict conformational changes and interaction sites.

  • Protein-protein docking: Computational prediction of GET1 interactions with partners like GET2 and GET3.

  • Evolutionary coupling analysis: Identifying co-evolving residues that might represent functional interaction sites.

  • Machine learning approaches: Training algorithms on known membrane protein interactions to predict novel GET1 interaction partners.

How should researchers interpret phenotypic changes in GET1 mutant strains?

Interpreting phenotypic changes in GET1 mutant strains requires careful consideration:

  • Direct vs. indirect effects: Distinguish between phenotypes directly caused by GET1 dysfunction versus secondary effects from broader disruption of ER homeostasis.

  • Compensatory mechanisms: Assess whether other cellular systems compensate for GET1 dysfunction, potentially masking phenotypes.

  • Growth condition dependency: Evaluate phenotypes under various stress conditions, as GET1 function may become more critical under specific stresses.

  • Quantitative assessment: Use quantitative methods to measure phenotypic changes rather than relying solely on qualitative observations.

  • Comparative analysis: Compare phenotypes to those observed in other GET pathway mutants to determine pathway-specific versus protein-specific effects.

What statistical approaches are most appropriate for analyzing GET1 functional data?

When analyzing GET1 functional data, consider these statistical approaches:

  • For protein interaction studies: Use appropriate statistical tests to determine binding affinities and specificities (Kd values), with multiple technical and biological replicates.

  • For phenotypic analyses: Apply ANOVA or mixed-effects models when comparing multiple strains under various conditions.

  • For omics data: Employ false discovery rate corrections for multiple hypothesis testing when analyzing high-throughput datasets.

  • For growth/survival data: Consider time-to-event analysis (survival analysis) rather than endpoint measurements.

  • For structure-function correlations: Use regression analysis to correlate specific GET1 sequence variations with functional parameters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.