Recombinant Lodderomyces elongisporus Golgi to ER traffic protein 2 (GET2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
GET2; LELG_00360; Golgi to ER traffic protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-357
Protein Length
full length protein
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Target Names
GET2
Target Protein Sequence
MSETTDKQLTEAEKRKLLRERRLAKMAQGKASDRLNTILSQGSSVKSVSPPAVTSVLENK ATKSTDTATVTDSSTNATSVSPSAAKATPTSTGVSSAISDFDDPEIQDISDVAVNNSGVL ALGNLSGLDSNNPSQPNLDEMFQKIMQQQSQHNCDNDNNGENNPMAEMLKMFNSMGGGDN NGGLGGFDSMFSGSPNSPPPESISPEMMKYQADLAKYHTYQEQLWQFRFLVVRILATIFN FAYHFITIPSFTASNHAYVRDLSEVYPLLGFMTIFTSIEVVIIATYYLLFTKLGLFHASN QKSFILKGISTLSMFVPQLLRYEPLVATFLGYKELLGIFVGDLSLVVVMFGLLSFSN
Uniprot No.

Target Background

Function

Essential for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum (ER). In conjunction with GET1, it functions as a membrane receptor for soluble GET3, which recognizes and selectively binds the transmembrane domain of TA proteins within the cytosol. The GET complex collaborates with the HDEL receptor ERD2 to facilitate the ATP-dependent retrieval of resident ER proteins containing a C-terminal H-D-E-L retention signal, transporting them from the Golgi apparatus back to the ER.

Database Links
Protein Families
GET2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and basic function of Lodderomyces elongisporus GET2?

Lodderomyces elongisporus Golgi to ER traffic protein 2 (GET2) is a full-length protein consisting of 357 amino acids that functions primarily in the retrograde transport pathway between the Golgi apparatus and the endoplasmic reticulum . The protein has a UniProt accession number of A5DSM4 and is encoded by the GET2 gene (ORF name: LELG_00360) . Structurally, GET2 contains hydrophobic regions that suggest transmembrane domains, particularly in the C-terminal portion, which is characteristic of proteins involved in vesicular trafficking . The protein participates in maintaining cellular homeostasis by facilitating the recycling of proteins and lipids between these two critical organelles, thus contributing to the secretory pathway's proper functioning in this yeast species.

How does L. elongisporus compare to other species in the context of GET2 research?

Lodderomyces elongisporus is often mistakenly identified as an atypical form of Candida parapsilosis in clinical settings, but D1/D2 sequence analysis has definitively distinguished it as a separate species . This taxonomic distinction is significant for GET2 research because it affects how we interpret functional conservation across species. L. elongisporus is an RG-1 organism that has been isolated from diverse sources including soft drinks, cocoa fermentations, soil, and human clinical samples such as blood infections and infected fingernails . When examining GET2 across species, researchers should consider that L. elongisporus forms pseudohyphae and produces ascospores, characteristics that may influence protein trafficking pathways compared to non-ascospore forming yeasts . These differences make it a valuable comparative model in evolutionary studies of the GET pathway.

What are the standard expression systems for recombinant L. elongisporus GET2 production?

The standard expression system for recombinant L. elongisporus GET2 production is Escherichia coli, typically with an N-terminal His-tag to facilitate purification . The full-length protein (amino acids 1-357) is expressed in this bacterial system, allowing for high-yield production of the target protein . While E. coli remains the predominant expression system due to its efficiency and cost-effectiveness, researchers should consider the potential impact of this prokaryotic expression on a eukaryotic protein's folding and post-translational modifications. Alternative expression systems such as Pichia pastoris or Saccharomyces cerevisiae might provide more native-like modifications but typically with lower yields. The expression construct design should account for codon optimization for the host organism to maximize protein production efficiency.

What are the optimal storage and handling conditions for recombinant L. elongisporus GET2?

The optimal storage conditions for recombinant L. elongisporus GET2 involve maintaining the protein at -20°C for routine storage, with -80°C recommended for extended preservation periods . The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during freeze-thaw cycles . For working solutions, it is advisable to aliquot the protein and store working portions at 4°C for no more than one week to prevent degradation . Repeated freeze-thaw cycles should be strictly avoided as they can compromise protein integrity and functionality . When reconstituting lyophilized preparations, researchers should use deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL and consider adding glycerol to a final concentration of 5-50% for cryoprotection . Prior to opening any vial, brief centrifugation is recommended to collect the contents at the bottom of the container.

How can researchers verify the purity and functionality of recombinant GET2 preparations?

Researchers can verify the purity of recombinant L. elongisporus GET2 preparations primarily through SDS-PAGE analysis, with commercial preparations typically exceeding 90% purity . For functional validation, several complementary approaches are recommended. First, Western blotting with anti-His antibodies can confirm the presence of the tagged protein at the expected molecular weight. Second, circular dichroism spectroscopy can assess proper protein folding by analyzing secondary structure elements. Third, functional assays should be employed to verify biological activity, such as in vitro binding assays with known interaction partners in the GET pathway, including GET1 and GET3. Additionally, researchers can perform reconstitution experiments in liposomes to evaluate membrane insertion capabilities, reflecting the protein's native function in facilitating protein trafficking between the Golgi and ER.

What methodological considerations are important when designing experiments involving GET2?

When designing experiments involving L. elongisporus GET2, researchers must consider several methodological aspects for reliable results. First, buffer composition is critical—maintaining physiological pH (7.2-8.0) and including stabilizing agents such as glycerol can preserve protein functionality . Second, researchers should be mindful of potential tag interference with protein function; while the His-tag facilitates purification, it may affect protein-protein interactions or membrane association in some experimental contexts. Third, temperature control during experimental procedures is essential, as the protein demonstrates optimal activity at temperatures reflecting yeast physiological conditions (25-30°C). Fourth, when studying membrane-protein interactions, the lipid composition of artificial membranes should mimic the native ER/Golgi environment for physiologically relevant observations. Finally, researchers should implement appropriate controls, including tag-only proteins and known functional mutants, to distinguish specific GET2-mediated effects from experimental artifacts.

How can researchers effectively study the interaction network of GET2 in vesicular trafficking?

To comprehensively study the interaction network of GET2 in vesicular trafficking, researchers should employ a multi-faceted approach combining in vitro and in vivo methods. Co-immunoprecipitation using anti-GET2 antibodies or pull-down assays leveraging the His-tag can identify direct binding partners in cellular lysates . For higher resolution analysis, researchers can utilize techniques such as proximity labeling (BioID or APEX) by fusing these enzymes to GET2, enabling the identification of both stable and transient interactors in the native cellular environment. Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can verify specific interactions and their subcellular localization. For system-level understanding, quantitative proteomics comparing wild-type and GET2-knockout strains can reveal broader effects on the proteome. These approaches should be complemented with functional assays measuring vesicular transport efficiency to correlate physical interactions with physiological outcomes in the GET pathway.

What strategies can be employed to elucidate the structural dynamics of GET2 during protein trafficking?

Elucidating the structural dynamics of GET2 during protein trafficking requires sophisticated biophysical and computational approaches. Researchers should consider hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map conformational changes upon binding to interaction partners or membrane insertion. Single-molecule Förster resonance energy transfer (smFRET) can provide insights into protein dynamics in real-time by strategically placing fluorophores on GET2 to monitor distance changes during functional cycles. Cryo-electron microscopy is particularly valuable for capturing different conformational states of GET2-containing complexes. For membrane-associated dynamics, solid-state NMR can characterize the orientation and insertion depth of transmembrane segments within lipid bilayers. These experimental approaches should be complemented with molecular dynamics simulations to model atomic-level movements during trafficking events. Together, these methods can reveal how structural reorganization of GET2 facilitates its function in orchestrating Golgi-to-ER vesicular transport.

How does the amino acid sequence of L. elongisporus GET2 contribute to its functional specificity compared to homologs in other species?

The amino acid sequence of L. elongisporus GET2 contains several distinctive features that likely contribute to its functional specificity compared to homologs in other fungal species . The protein sequence (MSETTDKQLTEAEKRKLLRERRLAKMAQGKASDRLNTILSQGSSVKSVSPPAVTSVLENKATKSTDTATVTDSSTNATSVSPSAAKATPTSTGVSSAISDFDDPEIQDISDVAVNNSGVLALGNLSGLDSNNPSQPNLDEMFQKIMQQQSQHNCDNDNNGENNPMAEMLKMFNSMGGGDNNGGLGGFDSMFSGSPNSPPPESISPEMMKYQADLAKYHTYQEQLWQFRFLVVRILATIFNFAYHFITIPSFTASNHAYVRDLSEVYPLLGFMTIFTSIEVVIIATYYLLFTKLGLFHASNQKSFILKGISTLSMFVPQLLRYEPLVATFLGYKELLGIFVGDLSLVVVMFGLLSFSN) features hydrophobic C-terminal regions that likely form transmembrane domains essential for membrane anchoring . Comparative sequence analysis reveals that while the core functional domains show conservation across species, L. elongisporus GET2 contains unique sequence motifs, particularly in the cytoplasmic regions, which may mediate species-specific protein interactions. Site-directed mutagenesis studies targeting these distinctive regions, followed by functional assays, can help identify the amino acid residues critical for L. elongisporus-specific functions in the GET pathway.

What is currently known about the role of GET2 in L. elongisporus biology and pathogenicity?

The role of GET2 in L. elongisporus biology extends beyond basic cellular functions to potential implications in pathogenicity, although research in this specific area remains limited. As a component of the GET pathway, the protein is fundamentally involved in tail-anchored protein insertion into the ER membrane, which affects multiple cellular processes including protein secretion and membrane organization . Given that L. elongisporus has been isolated from human clinical samples including blood infections and infected fingernails, GET2 may indirectly contribute to pathogenicity by facilitating the trafficking of virulence factors . The organism's capability to form pseudohyphae, a morphological transition often associated with increased virulence in pathogenic fungi, may also depend on proper GET pathway function for membrane protein localization . Comparative studies with the better-characterized Candida species could provide insights into how GET2-mediated protein trafficking contributes to L. elongisporus adaptation in host environments.

How does GET2 function within the broader context of the Golgi-ER trafficking machinery?

GET2 functions as a critical component within the broader Golgi-to-ER trafficking machinery, specifically as part of the GET complex responsible for tail-anchored protein insertion into the ER membrane . Within this pathway, GET2 works cooperatively with GET1 to form a membrane receptor complex that recognizes the GET3-tail-anchored protein complex arriving at the ER membrane . The coordinated action of these proteins ensures proper insertion of tail-anchored proteins, which are critical for various cellular functions including vesicle fusion, protein translocation, and apoptosis regulation. GET2's specific role involves initial recognition of the GET3-substrate complex and facilitating the transfer of tail-anchored proteins to GET1 for final membrane insertion. This process represents a highly conserved mechanism across eukaryotic organisms, underscoring its fundamental importance in cellular homeostasis and protein targeting.

What phenotypic consequences have been observed in GET2 knockout or mutation studies?

While specific GET2 knockout studies in L. elongisporus have not been extensively documented, research in related yeast species provides insights into potential phenotypic consequences. GET2 disruption typically results in significant cellular defects due to impaired tail-anchored protein insertion into the ER membrane. These defects include endoplasmic reticulum stress, altered protein secretion profiles, and compromised cellular growth under standard conditions. Under stress conditions, GET2-deficient cells show increased sensitivity to temperature variations, oxidative stress, and unfolded protein response activation. At the ultrastructural level, electron microscopy reveals abnormal membrane organizations, particularly at the ER-Golgi interface. Genetic interaction studies have demonstrated synthetic lethality with mutations in genes involved in alternative membrane protein insertion pathways, highlighting the essential nature of this cellular process. In pathogenic contexts, GET2 mutations may attenuate virulence by compromising the trafficking of factors required for host interaction and invasion.

How does L. elongisporus GET2 compare structurally and functionally to its homologs in Candida and Saccharomyces species?

L. elongisporus GET2 shares significant structural and functional similarities with its homologs in Candida and Saccharomyces species, reflecting the evolutionary conservation of the GET pathway across fungi . Sequence alignment analysis reveals approximately 60-70% sequence identity with Candida species homologs and slightly lower identity with Saccharomyces cerevisiae GET2. The C-terminal transmembrane domains show the highest conservation, indicating their critical importance in membrane anchoring and function . Despite these similarities, L. elongisporus GET2 contains unique sequence features, particularly in the cytoplasmic N-terminal region, which may reflect species-specific adaptations in protein-protein interactions or regulatory mechanisms. Functionally, complementation experiments in S. cerevisiae GET2 deletion strains with the L. elongisporus homolog would determine the degree of functional conservation. These comparative analyses contribute to our understanding of how GET pathway components have evolved across fungal lineages while maintaining their essential cellular functions.

What physiological adaptations might explain GET2 sequence variations across yeast species?

The sequence variations observed in GET2 across yeast species, including L. elongisporus, likely reflect physiological adaptations to different ecological niches and lifestyle requirements . L. elongisporus has been isolated from diverse environments ranging from food sources to human clinical samples, suggesting adaptation to various growth conditions and stress factors . Specific sequence variations in GET2 may optimize protein trafficking efficiency under these diverse conditions. For instance, variations in the cytoplasmic domains might modulate interaction affinities with GET3 or other trafficking components, influencing substrate selectivity or processing rates. Temperature adaptation is another significant factor, as L. elongisporus can grow at 37°C (human body temperature), which may require specific adaptations in membrane protein dynamics and trafficking pathways . Additionally, differences in GET2 sequences might reflect co-evolution with species-specific tail-anchored proteins that require insertion into the ER membrane for proper cellular function or virulence.

What methodological approaches are most effective for comparative studies of GET pathway components across fungal species?

For effective comparative studies of GET pathway components across fungal species, researchers should implement a multi-tiered methodological approach. First, comprehensive bioinformatic analysis should be conducted, including phylogenetic reconstruction of GET proteins and identification of conserved motifs versus species-specific variations . Second, heterologous expression systems should be employed wherein GET2 from different species is expressed in a model organism (typically S. cerevisiae) with its native GET2 deleted, allowing for functional complementation assessment . Third, protein-protein interaction studies using techniques such as yeast two-hybrid or co-immunoprecipitation can identify species-specific differences in GET complex formation and binding partners. Fourth, in vitro reconstitution experiments with purified components from different species can directly compare biochemical activities and substrate preferences. Finally, structural studies using X-ray crystallography or cryo-EM can provide atomic-level insights into structural adaptations. This integrated approach yields a comprehensive understanding of GET pathway evolution and adaptation across fungal species.

What are the recommended controls and validation steps for GET2 functional assays?

When designing functional assays for L. elongisporus GET2, researchers should implement several essential controls and validation steps to ensure reliable and interpretable results. First, include both positive and negative controls: wild-type GET2 protein serves as a positive control, while a known non-functional mutant (typically with mutations in conserved transmembrane domains) provides a negative control . Second, validate antibody specificity when using immunological detection methods by confirming absence of signal in GET2 knockout preparations or with peptide competition assays. Third, for reconstitution experiments, control for lipid composition effects by comparing results across different membrane formulations. Fourth, when studying protein-protein interactions, validate specific binding with competition assays using excess unlabeled protein. Fifth, confirm physiological relevance by correlating in vitro findings with in vivo phenotypes using genetic approaches such as complementation of GET2 mutations. Finally, dose-response experiments should be performed to establish the concentration-dependence of observed effects, distinguishing specific interactions from non-specific binding events.

How can researchers effectively design experiments to study GET2 interactions with other components of the GET pathway?

Designing effective experiments to study GET2 interactions with other GET pathway components requires a strategic combination of in vitro and in vivo approaches. Researchers should begin with purified component binding assays using techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to determine direct binding parameters including affinity constants, association/dissociation rates, and thermodynamic profiles . These should be complemented with structural studies such as co-crystallization or cryo-EM to determine interaction interfaces at atomic resolution. For cellular context validation, techniques such as fluorescence correlation spectroscopy can monitor dynamic interactions in living cells. Mutational analysis targeting predicted interaction interfaces should be performed to identify critical residues, followed by functional rescue experiments to confirm their physiological significance. To study the sequential assembly of larger GET complexes, researchers can employ size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to monitor complex formation and composition. Finally, kinetic experiments monitoring tail-anchored protein insertion rates can connect physical interactions with functional outcomes in the GET pathway.

What are the methodological challenges in studying membrane-associated functions of GET2, and how can they be addressed?

Studying the membrane-associated functions of GET2 presents several methodological challenges that require specialized approaches . First, maintaining protein stability and proper folding during purification is challenging for transmembrane proteins like GET2; this can be addressed by using mild detergents such as DDM or LMNG during extraction, followed by reconstitution into nanodiscs or liposomes for functional studies. Second, achieving physiologically relevant membrane compositions for in vitro assays is difficult; researchers should systematically vary lipid compositions to identify optimal conditions that support GET2 function. Third, distinguishing specific functions of GET2 from those of its binding partner GET1 can be complicated; researchers can address this by using chimeric proteins or specific inhibitory antibodies targeting distinct components. Fourth, real-time monitoring of membrane insertion events presents technical difficulties; this can be overcome using fluorescence-based assays with labeled tail-anchored proteins and FRET-based reporters integrated into artificial membranes. Finally, reconciling in vitro findings with in vivo relevance remains challenging; complementary approaches using cell-based assays with quantitative readouts of GET pathway function provide necessary validation of mechanistic insights gained from reconstituted systems.

What mass spectrometry approaches are most informative for studying GET2 post-translational modifications?

For comprehensive analysis of GET2 post-translational modifications (PTMs), researchers should employ a multi-faceted mass spectrometry approach. Bottom-up proteomics using liquid chromatography-tandem mass spectrometry (LC-MS/MS) following enzymatic digestion provides broad PTM coverage, with enrichment strategies such as titanium dioxide (TiO₂) affinity for phosphorylation or lectin affinity for glycosylation increasing detection sensitivity for specific modifications . Top-down proteomics analyzing intact GET2 can reveal modification stoichiometry and co-occurrence patterns. Targeted approaches such as parallel reaction monitoring (PRM) or multiple reaction monitoring (MRM) offer increased sensitivity for quantifying specific modifications across experimental conditions. For site-specific analysis, electron transfer dissociation (ETD) or electron capture dissociation (ECD) fragmentation methods are superior to collision-induced dissociation (CID) as they preserve labile modifications. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can further reveal how PTMs affect protein conformation and dynamics. Together, these complementary approaches provide a comprehensive view of GET2 modifications and their functional implications in regulating Golgi-to-ER trafficking.

How can structural biology techniques be optimized to study GET2 conformation during different stages of protein trafficking?

Optimizing structural biology techniques to study GET2 conformational changes during protein trafficking requires strategic adaptation of methods to capture different functional states . For X-ray crystallography, researchers should explore various crystallization conditions with GET2 alone and in complex with interaction partners, potentially using antibody fragments to stabilize specific conformations. Cryo-electron microscopy is particularly valuable for visualizing GET2 in membrane environments and capturing conformational heterogeneity without crystallization constraints. Time-resolved structural studies can be achieved using techniques such as time-resolved X-ray solution scattering or time-resolved cryo-EM with rapid mixing devices to capture transient intermediates during the trafficking cycle. For dynamics information, nuclear magnetic resonance (NMR) with selective isotope labeling can provide residue-specific information on protein mobility and conformational exchange. Integration of structural data with molecular dynamics simulations can further extend experimental observations to predict conformational transitions not captured experimentally. This multi-technique approach provides complementary insights into GET2 structural dynamics during different stages of protein trafficking.

What computational approaches can predict functional impacts of GET2 mutations in different yeast species?

Advanced computational approaches can effectively predict the functional impacts of GET2 mutations across different yeast species through several complementary methods . Homology modeling using experimental structures of related proteins as templates can generate reliable structural models of L. elongisporus GET2, upon which in silico mutagenesis can be performed. Molecular dynamics simulations of these models can reveal how specific mutations affect protein stability, conformational flexibility, and interaction potential on nanosecond to microsecond timescales. Machine learning algorithms trained on existing mutation effect datasets can predict functional consequences based on sequence conservation patterns and physicochemical properties. Protein-protein docking simulations can assess how mutations might alter binding interfaces with GET1, GET3, or tail-anchored protein substrates. Coevolutionary analysis across multiple fungal species can identify compensatory mutations that maintain function despite sequence divergence. These computational predictions should guide experimental design by prioritizing mutations likely to have significant functional impacts, followed by experimental validation through biochemical assays and phenotypic studies in relevant yeast models.

What emerging technologies hold promise for advancing our understanding of L. elongisporus GET2 function?

Several emerging technologies hold significant promise for advancing our understanding of L. elongisporus GET2 function in the coming years. CRISPR-Cas9 genome editing optimized for L. elongisporus will enable precise modification of the native GET2 gene, allowing for targeted mutations and fluorescent tagging at the endogenous locus . Advanced imaging technologies such as lattice light-sheet microscopy combined with single-particle tracking can visualize GET2 dynamics at unprecedented spatiotemporal resolution in living cells. Proximity labeling approaches using engineered peroxidases (APEX) or biotin ligases (TurboID) fused to GET2 will map its dynamic interactome under various conditions. Cryo-electron tomography of cellular sections can visualize GET2-containing complexes in their native membrane environment at molecular resolution. Finally, integrative structural biology approaches combining multiple data types (crystallography, cryo-EM, crosslinking mass spectrometry, and SAXS) will generate comprehensive structural models of GET2 in different functional states. These technologies will collectively provide a multi-scale understanding of GET2 function from molecular interactions to cellular consequences.

What are the most significant unanswered questions regarding L. elongisporus GET2 and the GET pathway?

Despite advances in our understanding of the GET pathway, several significant questions regarding L. elongisporus GET2 remain unanswered. First, how do the unique sequence features of L. elongisporus GET2 contribute to species-specific functions or adaptations, particularly in relation to the organism's diverse ecological niches including potential pathogenicity ? Second, what is the precise structural mechanism by which the GET1-GET2 complex coordinates with GET3 to ensure proper insertion of tail-anchored proteins, and how might this differ in L. elongisporus compared to model yeasts? Third, how is GET2 function regulated in response to different cellular stresses or environmental conditions, and what post-translational modifications might mediate this regulation? Fourth, does L. elongisporus possess alternative pathways for tail-anchored protein insertion that complement or compensate for the GET pathway? Fifth, how has the GET pathway evolved across fungal lineages, and what can L. elongisporus tell us about this evolutionary trajectory? Addressing these questions will require integrated approaches combining genomics, structural biology, biochemistry, and cell biology specifically adapted for this non-model yeast species.

How might research on L. elongisporus GET2 contribute to broader understanding of eukaryotic protein trafficking mechanisms?

Research on L. elongisporus GET2 has significant potential to contribute to our broader understanding of eukaryotic protein trafficking mechanisms in several key ways . As a non-conventional yeast species with both commensal and potentially pathogenic lifestyles, L. elongisporus represents an evolutionary intermediate that can provide insights into adaptation of core trafficking machinery across different ecological contexts . Comparative studies between L. elongisporus GET2 and homologs in well-studied model organisms can reveal which aspects of the GET pathway are universally conserved versus those that show species-specific adaptations. The unique aspects of L. elongisporus biology, including its ability to form ascospores and grow at mammalian body temperature, provide opportunities to study how protein trafficking pathways are modulated during these specialized processes . From a broader perspective, understanding GET2 function in diverse species enhances our knowledge of membrane protein biogenesis across eukaryotes, potentially revealing novel regulatory mechanisms or auxiliary factors. Finally, as a potential pathogen, L. elongisporus studies may reveal trafficking-dependent virulence mechanisms that could serve as targets for antifungal development, bridging basic mechanistic research with potential clinical applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.