Recombinant Lodderomyces elongisporus Mitochondrial inner membrane i-AAA protease complex subunit MGR1 (MGR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer requirements.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MGR1; LELG_01282; Mitochondrial inner membrane i-AAA protease complex subunit MGR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-406
Protein Length
full length protein
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Target Names
MGR1
Target Protein Sequence
MGYIPPPGDNDDNGKKSNKKTQNTSKPISSDSTPDGTTITIINPMSLIPRNPSFGLIWGP LTPASDNRPAMYTMVALQIAIGVRFFRYARTHLRRHPVPQAQFHAPPGLGVNSMISTTAN QTYSAPPQQFLRRSKGDVFKSILAITTGSLLIFGSGLEIARMMLPYDPWYDEAQFYRKQA VRNGDKPNFWFGAYQYYQPMTYKEWHSKVSKWIDSVEKEIKVDETTFVIDKDGKARGGIG PAGVGYVNGAGQQSGAASAAAAVAKPLFQIRNRAKYQQIHAKLYNANETRMRELLANELN DTNVNELNKAERLDKILEGKSDLVNPNFNKPSISLGNHPMESDDEFEMVWLNFEPWDELK METDYDIRLIPRYASVEELEQVDEGELFVVKKEELGETDNVVNESS
Uniprot No.

Target Background

Function
A component of the mitochondrial inner membrane i-AAA protease complex; essential for the turnover of mitochondrial inner membrane proteins.
Database Links
Protein Families
MGR1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Lodderomyces elongisporus and what are its key characteristics?

Lodderomyces elongisporus is a yeast-like fungal organism that has been isolated from diverse sources including soft drinks, juice concentrates, natural fermentations of cocoa, soil, infected fingernails, human blood, and baby cream. It was previously misidentified as an atypical form of Candida parapsilosis before D1/D2 sequence analysis revealed its distinct identity .

L. elongisporus has the following key morphological and physiological characteristics:

  • White to cream colored colonies with smooth, glabrous, yeast-like appearance

  • Ellipsoid to elongate budding blastoconidia (2.6-6.3 x 4-7.4 μm)

  • Abundant, much-branched pseudohyphae production

  • Asci formation with one or rarely two long-ellipsoid ascospores

  • Negative germ tube formation

  • Specific fermentation and assimilation patterns as detailed in the table below :

Physiological CharacteristicsResults
Glucose fermentationPositive
Galactose fermentationNegative
Sucrose fermentationNegative
Maltose fermentationNegative
Lactose fermentationNegative
Trehalose fermentationPositive
Growth at 37°CPositive

What is the mitochondrial inner membrane i-AAA protease complex and what role does MGR1 play in it?

The mitochondrial inner membrane i-AAA protease complex is a crucial component of the mitochondrial protein quality control system. The complex consists of Yme1 as the core protease component along with two adapter proteins, Mgr1 and Mgr3. This proteolytic machinery is responsible for degrading proteins in the mitochondrial intermembrane space (IMS) and the inner membrane .

MGR1 functions as an adapter protein within this complex that:

  • Recognizes substrate proteins specifically in the intermembrane space domains

  • Facilitates recruitment of these substrates to the Yme1 protease for degradation

  • Works cooperatively with Mgr3 as part of the recognition machinery

  • Helps maintain mitochondrial proteostasis by identifying and targeting proteins for degradation

Research has shown that both MGR1 and MGR3 adapter proteins are necessary for efficient substrate recruitment, as demonstrated through immunoprecipitation and in vivo site-specific photo-cross-linking experiments .

What are the recommended methods for identifying and distinguishing L. elongisporus from related Candida species?

L. elongisporus is often misidentified due to its phenotypic similarities with members of the Candida parapsilosis complex. For reliable identification, researchers should employ molecular techniques rather than relying solely on conventional biochemical methods . The following methodological approaches are recommended:

Primary molecular identification methods:

  • ITS region sequencing: Internal transcribed spacer (ITS) fungal sequencing has proven highly effective in distinguishing L. elongisporus from C. parapsilosis and related species .

  • MALDI-TOF MS analysis: Matrix-assisted laser desorption ionization-time of flight mass spectrometry has demonstrated accuracy in identifying L. elongisporus from cultured isolates .

  • D1/D2 LSU rRNA gene sequencing: This approach provides definitive species identification that conventional methods cannot achieve .

Supportive phenotypic methods:

  • Ascospore formation observation: On V8 agar after 7-10 days at 25°C, L. elongisporus produces characteristic ascospores that are not seen in Candida species .

  • Physiological testing: While not definitive alone, patterns of carbohydrate assimilation and fermentation provide supporting evidence.

When conducting species identification, it is essential to use at least one molecular method in conjunction with phenotypic characteristics for conclusive results, especially in clinical or research scenarios where accurate species identification is critical .

What protocols are recommended for recombinant expression of L. elongisporus MGR1?

While working with recombinant L. elongisporus MGR1, researchers should consider the following protocol recommendations:

Expression System Selection:

  • Heterologous expression in Saccharomyces cerevisiae is often preferred due to the similarity in posttranslational modifications and protein folding machinery between yeast species.

  • E. coli systems can be used for structural studies but may require refolding protocols to obtain functional protein.

Expression Vector Construction:

  • Amplify the MGR1 gene from L. elongisporus genomic DNA using high-fidelity polymerase.

  • Include appropriate affinity tags (His6 or FLAG) for purification, ideally at the C-terminus to avoid interference with mitochondrial targeting sequences.

  • Consider using inducible promoters to control expression levels.

Purification Strategy:

  • For studies requiring native protein-protein interactions, employ gentle detergent solubilization (0.5-1% digitonin or 1% DDM) to preserve the integrity of membrane protein complexes.

  • Implement a two-step purification process: initial affinity chromatography followed by size exclusion chromatography to isolate intact i-AAA protease complexes.

Functional Verification Methods:

  • Circular dichroism to assess proper folding

  • ATPase assays when studying the complex with Yme1

  • Substrate degradation assays to confirm proteolytic activity

The selection of expression and purification methods should be tailored to the specific research questions being addressed, with particular attention to maintaining the native structure and function of this membrane-associated adapter protein.

How does the Yme1-Mgr1-Mgr3 complex in L. elongisporus recognize and process mitochondrial outer membrane proteins?

The processing of mitochondrial outer membrane (MOM) proteins by the Yme1-Mgr1-Mgr3 complex represents a sophisticated quality control mechanism. Based on current research, this complex functions through the following mechanism:

  • Substrate Recognition: Both Mgr1 and Mgr3 adapters specifically recognize the intermembrane space (IMS) domains of mitochondrial outer membrane proteins. This recognition is likely mediated through specific protein-protein interaction motifs .

  • Substrate Recruitment: Following recognition, the adapters facilitate recruitment of the substrate to the Yme1 protease component. Immunoprecipitation and in vivo site-specific photo-cross-linking experiments have demonstrated this recruitment mechanism .

  • ATP-Dependent Translocation: The ATPase activity of Yme1 provides the energy required to dislocate the cytoplasmic domain of the substrate into the intermembrane space. This translocation step is critical for positioning the substrate for proteolytic processing .

  • Proteolytic Degradation: Once properly positioned, the catalytic domain of Yme1, which faces the intermembrane space, degrades the substrate protein.

This mechanism represents a parallel quality control system working alongside the cytoplasmic ubiquitin-proteasome system, allowing for comprehensive surveillance of mitochondrial outer membrane proteins from both the cytoplasmic and intermembrane space sides .

Understanding this mechanism has significant implications for research on mitochondrial protein homeostasis and potential therapeutic approaches for mitochondrial disorders.

What experimental approaches can distinguish between Mgr1-dependent and Mgr1-independent protein degradation pathways?

To effectively distinguish between Mgr1-dependent and Mgr1-independent degradation pathways, researchers should employ a multi-faceted experimental strategy:

Genetic Approaches:

  • Generate MGR1 deletion and conditional mutants in L. elongisporus using CRISPR-Cas9 or traditional homologous recombination techniques.

  • Create complementation strains expressing wild-type or domain-specific mutants of MGR1 to identify functional regions critical for substrate selectivity.

Biochemical Methods:

  • In vitro reconstitution assays with purified components to directly assess the dependency of substrate degradation on MGR1.

  • Pulse-chase experiments in wild-type versus MGR1-deleted strains to monitor degradation kinetics of potential substrates.

  • Crosslinking and immunoprecipitation studies to capture direct interactions between MGR1 and substrate proteins.

Proteomic Approaches:

  • Comparative proteomic analysis of mitochondrial fractions from wild-type and MGR1-deficient strains to identify accumulated proteins.

  • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) combined with mass spectrometry to quantitatively measure protein degradation rates in different genetic backgrounds.

Data Analysis:

  • Proteins whose degradation is significantly delayed in MGR1-deleted strains but normal in complemented strains can be classified as MGR1-dependent.

  • Proteins degraded with similar kinetics regardless of MGR1 status represent MGR1-independent degradation pathways.

  • Proteins showing intermediate phenotypes may indicate partial redundancy in the degradation pathways.

This comprehensive approach allows researchers to categorize mitochondrial protein degradation pathways and understand the specific role of MGR1 in proteostasis maintenance.

How is L. elongisporus involved in human infections and what are the clinical implications for researchers?

L. elongisporus has emerged as a clinically significant fungal pathogen capable of causing various infections. Understanding its clinical profile is essential for researchers working on virulence, pathogenesis, or therapeutic development:

Documented Clinical Manifestations:

  • Fungemia (blood infections) represents the most commonly reported clinical presentation

  • Endocarditis has been documented in multiple cases

  • Meningitis, representing the first described case in the literature as of 2021

  • Catheter-tip infections associated with indwelling medical devices

Risk Factors for L. elongisporus Infections:

  • Presence of central venous catheters

  • Prior chemotherapy and immunosuppression

  • Lymphopenia

  • Prior gastrointestinal surgery

  • Frequent healthcare system exposure

Diagnostic Challenges:
L. elongisporus has been historically underreported due to misidentification as Candida parapsilosis using conventional methods. Only with molecular techniques like ITS sequencing and MALDI-TOF has accurate identification become possible . This suggests that the true clinical burden may be higher than currently recognized.

Treatment Approaches from Case Studies:
The following treatments have been used in documented cases with variable success:

Antifungal AgentClinical ContextOutcome
FluconazoleCNS infection, catheter-tip infectionSurvival reported
Liposomal amphotericin + voriconazoleMeningitisSurvival reported
CaspofunginFungemia, endocarditisMixed outcomes
Micafungin/AnidulafunginFungemia, endocarditisSurvival reported
Amphotericin + flucytosineEndocarditisSurvival reported

For researchers studying L. elongisporus pathogenesis, these clinical findings provide important context for designing relevant in vitro and in vivo models that recapitulate human disease scenarios .

What is known about the antifungal susceptibility profile of L. elongisporus and how might MGR1 function relate to drug resistance?

The antifungal susceptibility profile of L. elongisporus remains incompletely characterized, with current understanding largely extrapolated from limited case reports and related species:

Current Knowledge on Antifungal Susceptibility:

  • No standardized susceptibility breakpoints exist specifically for L. elongisporus

  • Susceptibility profiles of Candida parapsilosis are often used as a surrogate

  • Clinical responses have been observed with echinocandins (caspofungin, micafungin, anidulafungin), azoles (fluconazole, voriconazole), and polyenes (amphotericin B)

Potential Role of MGR1 in Drug Resistance:
While direct evidence linking MGR1 to antifungal resistance in L. elongisporus is currently limited, several theoretical mechanisms warrant investigation:

  • Mitochondrial Quality Control and Stress Response: As an adapter protein in the i-AAA protease complex, MGR1 contributes to mitochondrial proteostasis. Dysfunction in this system could potentially alter cellular stress responses to antifungal agents, particularly those affecting mitochondrial function.

  • Metabolic Adaptation: MGR1-mediated protein degradation may influence metabolic adaptations that occur during antifungal exposure, potentially contributing to tolerance mechanisms.

  • Membrane Protein Homeostasis: Given the role of MGR1 in recognizing membrane proteins, alterations in MGR1 function could affect membrane composition and potentially drug permeability or efflux.

Research Directions:

  • Comparative susceptibility testing of wild-type versus MGR1-deleted strains

  • Transcriptomic analysis during antifungal exposure to identify MGR1-dependent responses

  • Investigation of MGR1 upregulation or modification during acquired drug resistance development

Understanding the potential role of MGR1 in antifungal responses could reveal novel resistance mechanisms and potentially identify new therapeutic targets for combination therapies .

How conserved is the structure and function of MGR1 between L. elongisporus and other fungal species?

The evolutionary conservation of MGR1 across fungal species provides valuable insights into its fundamental importance in mitochondrial quality control. Comparative analyses reveal:

Structural Conservation:

  • The core functional domains of MGR1 show significant sequence homology across diverse fungal lineages, particularly within the Saccharomycetales order

  • The substrate recognition domains that interact with the intermembrane space regions of target proteins appear to be the most highly conserved elements

  • C-terminal regions that mediate interactions with Yme1 show higher conservation than N-terminal regions

Functional Conservation:

  • The adapter role of MGR1 in the i-AAA protease complex appears to be preserved across fungal species

  • Studies in Saccharomyces cerevisiae have established MGR1's function in substrate recognition and recruitment to Yme1, which appears mechanistically similar in L. elongisporus

  • Complementation studies suggest functional interchangeability of MGR1 proteins from related species

Evolutionary Adaptations:

  • Species-specific variations exist, particularly in regions that may be involved in substrate specificity

  • Pathogenic fungi like L. elongisporus show some adaptations in MGR1 that may relate to their lifestyle and environmental niches

  • Some fungal lineages have evolved additional adapter proteins or modified MGR1 interaction networks

This conservation pattern suggests that MGR1's core function in mitochondrial protein quality control represents an ancient and fundamental process in fungal biology, while allowing for species-specific adaptations in substrate recognition that may reflect different metabolic or environmental demands .

What experimental approaches would best elucidate the unique aspects of L. elongisporus MGR1 compared to other fungal homologs?

To comprehensively investigate the unique aspects of L. elongisporus MGR1 compared to homologs in other fungi, researchers should implement a multi-disciplinary approach:

Comparative Genomic and Structural Analysis:

  • Perform phylogenetic analysis of MGR1 sequences across fungal species with emphasis on pathogenic vs. non-pathogenic lineages

  • Use homology modeling and structural prediction algorithms to identify L. elongisporus-specific structural features

  • Apply evolutionary trace methods to map conserved and divergent residues onto structural models

Functional Complementation Studies:

  • Express L. elongisporus MGR1 in S. cerevisiae mgr1Δ strains to assess functional complementation

  • Create chimeric proteins with domain swaps between L. elongisporus and other fungal MGR1 proteins to map functional domains

  • Evaluate phenotypic rescue under various stress conditions to identify condition-specific functions

Interaction Network Mapping:

  • Perform comparative interactome analysis using BioID or proximity labeling approaches

  • Compare MGR1-associated proteins between L. elongisporus and other fungi using quantitative proteomics

  • Validate key interactions through co-immunoprecipitation and bimolecular fluorescence complementation

Substrate Specificity Determination:

  • Identify and compare MGR1-dependent degradation substrates across fungal species using proteomic approaches

  • Analyze substrate binding preferences through peptide arrays or phage display technologies

  • Perform in vitro competition assays with recombinant proteins to quantify relative substrate affinities

Proposed Experimental Workflow:

  • Begin with bioinformatic analyses to generate hypotheses about unique features

  • Progress to functional studies in heterologous expression systems

  • Validate findings in L. elongisporus directly, if genetic manipulation systems are available

  • Correlate molecular findings with phenotypic outcomes in pathogenesis or stress response models

This comprehensive approach would reveal both the conserved core functions of MGR1 and the species-specific adaptations that may contribute to L. elongisporus biology and pathogenicity .

What are the potential implications of studying L. elongisporus MGR1 for understanding mitochondrial dysfunction in fungal pathogenesis?

The study of L. elongisporus MGR1 presents promising avenues for understanding the relationship between mitochondrial function and fungal pathogenesis:

Mitochondrial Quality Control in Virulence:

  • The Yme1-Mgr1-Mgr3 i-AAA protease complex represents a critical quality control mechanism that may influence fungal adaptation during host invasion

  • Disruptions in mitochondrial proteostasis could affect energy production, stress responses, and morphological transitions necessary for pathogenesis

  • MGR1's role in recognizing and facilitating degradation of damaged mitochondrial proteins may be particularly important during the oxidative stress conditions encountered within host immune cells

Host-Pathogen Interactions:

  • Mitochondrial function affects cellular metabolism, which in turn influences the fungal cell wall and membrane composition—key determinants in host immune recognition

  • The i-AAA protease system may play a role in modifying fungal surface molecules in response to host environments

  • L. elongisporus has been isolated from diverse infection sites including blood, heart valves, and central nervous system, suggesting adaptation to different host microenvironments

Therapeutic Implications:

  • Understanding MGR1's function could reveal new potential targets for antifungal development

  • Targeting protein quality control systems represents an emerging strategy in antimicrobial development

  • Combination therapies that simultaneously target mitochondrial function and traditional antifungal targets may enhance efficacy

Research Priority Areas:

  • Investigation of MGR1 expression and activity during different stages of infection

  • Comparative analysis of virulence in wild-type versus MGR1-deficient strains in animal models

  • Identification of MGR1-dependent substrates that specifically contribute to pathogenesis

  • Exploration of potential synergy between mitochondrial dysfunction and established virulence mechanisms

This research direction connects fundamental mitochondrial biology with clinical outcomes, potentially revealing novel therapeutic strategies for L. elongisporus infections, which have been documented to cause serious conditions including fungemia, endocarditis, and meningitis .

How might the study of recombinant L. elongisporus MGR1 contribute to broader understanding of eukaryotic mitochondrial quality control systems?

The study of recombinant L. elongisporus MGR1 offers significant opportunities to expand our understanding of fundamental principles in eukaryotic mitochondrial quality control:

Evolutionary Conservation of Mitochondrial Proteostasis:

  • L. elongisporus represents an interesting evolutionary position within the fungi, allowing for comparative studies of mitochondrial quality control across the eukaryotic domain

  • Analysis of MGR1 structure and function can reveal conserved mechanisms that may extend to other eukaryotes including higher organisms

  • Identification of core functional domains versus species-specific adaptations provides insight into the evolution of proteostasis networks

Mechanistic Insights into Membrane Protein Quality Control:

  • The unexpected finding that the Yme1-Mgr1-Mgr3 complex degrades outer membrane proteins from the intermembrane space side represents a paradigm shift in understanding mitochondrial membrane protein surveillance

  • This mechanism suggests parallel quality control pathways monitoring mitochondrial proteins from different cellular compartments

  • Understanding how MGR1 recognizes substrate proteins in the intermembrane space could reveal general principles applicable to other membrane quality control systems

Integration of Quality Control Networks:

  • MGR1 function represents one component of an integrated network of mitochondrial quality control that includes:

    • Protein-specific degradation (i-AAA and m-AAA proteases)

    • Organelle-level quality control (mitophagy)

    • Cellular stress responses (unfolded protein response)

  • Understanding how these systems communicate and compensate for each other has broad implications for cell biology

Methodological Advances:

  • Techniques developed for recombinant expression and functional analysis of L. elongisporus MGR1 could be applied to other challenging membrane-associated proteins

  • Reconstitution of the i-AAA protease complex with defined components allows for mechanistic dissection of complex proteolytic systems

  • Approaches to study protein translocation across membranes have applications beyond mitochondrial biology

Biomedical Relevance:

  • Mitochondrial dysfunction is implicated in numerous human diseases including neurodegeneration, metabolic disorders, and aging

  • Fundamental insights from fungal systems often translate to mammalian biology due to the evolutionary conservation of mitochondrial functions

  • Therapeutic approaches targeting protein quality control represent an emerging frontier in medicine

This research area connects fundamental questions about protein homeostasis with potential applications in understanding human mitochondrial diseases, highlighting the value of studying seemingly specialized components like L. elongisporus MGR1 for broader biological insights .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.