Recombinant Lodderomyces elongisporus Mitochondrial thiamine pyrophosphate carrier 1 (TPC1)

Shipped with Ice Packs
In Stock

Description

Introduction to Lodderomyces elongisporus TPC1

Lodderomyces elongisporus is a diploid ascomycete yeast that has gained increased attention in recent years both for its biotechnological applications and as an emerging human fungal pathogen. First discovered and described as Saccharomyces elongisporus in 1952 from Californian citrus concentrate, this yeast has since been isolated from diverse sources including soil, fermented food products, plants, hospital environments, and humans . The organism is closely related to the Candida parapsilosis species complex and shares similar physiological features, often leading to misidentification in clinical settings .

Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) is a specialized transport protein located in the inner mitochondrial membrane responsible for shuttling thiamine pyrophosphate (ThPP) between the cytosol and mitochondrial matrix. ThPP, the active form of vitamin B1 (thiamine), serves as an essential cofactor for several key enzymatic reactions in cellular metabolism. The recombinant form of L. elongisporus TPC1 has been produced to facilitate research into its structure, function, and potential applications.

Physicochemical Properties

Table 1: Physicochemical Properties of Recombinant L. elongisporus TPC1

PropertyCharacteristic
Length310 amino acids (full-length)
Expression SystemE. coli
Affinity TagHis (N-terminal)
FormLyophilized powder or solution
Storage BufferTris-based buffer, 50% glycerol
Recommended Storage-20°C to -80°C
StabilityUnstable to repeated freeze-thaw cycles

Biological Function of TPC1

The biological function of TPC1 has been extensively studied in Saccharomyces cerevisiae, providing insights into the likely function of L. elongisporus TPC1. In yeast, TPC1 serves as the mitochondrial carrier for the essential cofactor thiamine pyrophosphate (ThPP) . The transport characteristics and substrate specificity of TPC1 distinguish it from other mitochondrial carriers.

ThPP is synthesized in the cytosol by thiamine pyrophosphokinase and must be transported into mitochondria, where it serves as an essential cofactor for several enzymes including acetolactate synthase (ALS), pyruvate dehydrogenase, and oxoglutarate dehydrogenase (OGDH) . These enzymes play critical roles in cellular metabolism, particularly in amino acid biosynthesis and the tricarboxylic acid cycle.

Studies with S. cerevisiae TPC1 have shown that this carrier catalyzes both the uniport uptake of ThPP into mitochondria and the exchange between cytosolic ThPP and intramitochondrial thiamine monophosphate (ThMP) . The carrier co-transports ThPP with protons in a pH gradient-dependent manner, ensuring efficient import of this essential cofactor into the mitochondrial matrix.

Based on the high degree of conservation among mitochondrial carriers, L. elongisporus TPC1 likely performs similar functions, although species-specific variations in transport kinetics and regulation may exist.

Metabolic Significance

In the context of L. elongisporus metabolism, TPC1 likely plays a particularly important role given this yeast's capacity for polyunsaturated fatty acid (PUFA) production. L. elongisporus has been identified as a promising candidate for PUFA production, with recent research demonstrating its ability to efficiently accumulate lipids (54%) and synthesize short-chain PUFAs such as linoleic acid (22.67%) and α-linolenic acid (7.47%) . This metabolic capacity requires robust mitochondrial function, in which ThPP-dependent enzymes play essential roles.

Expression and Purification

The recombinant protein is typically produced by cloning the coding sequence of L. elongisporus TPC1 (UniProt ID: A5DX39) into an appropriate expression vector, transforming E. coli, inducing protein expression, and purifying using affinity chromatography. The resulting protein may be full-length (residues 1-310) or partial, depending on the specific product .

Comparative Analysis with TPC1 from Other Species

TPC1 is a highly conserved protein found across multiple fungal species. Comparative analysis of TPC1 from L. elongisporus with its counterparts from other species provides insights into evolutionary relationships and functional conservation.

Sequence Comparison

Table 3: Comparison of TPC1 Proteins from Different Fungal Species

SpeciesProtein LengthUniProt IDSequence Identity to L. elongisporus TPC1
Lodderomyces elongisporus310 aaA5DX39100%
Kluyveromyces lactis317 aaQ6CQR3Partial homology
Coccidioides immitis319 aaQ1E7P0Partial homology
Saccharomyces cerevisiaeNot specifiedYGR096wPartial homology

Functional Conservation

The function of TPC1 appears to be largely conserved across fungal species, with studies in S. cerevisiae providing the most detailed insights. In S. cerevisiae, TPC1 (encoded by YGR096w) was identified as the mitochondrial carrier for thiamine pyrophosphate through overexpression, reconstitution into phospholipid vesicles, and characterization of its transport properties .

Cells lacking the TPC1 gene exhibited reduced levels of ThPP in their mitochondria, decreased activity of ThPP-dependent enzymes such as acetolactate synthase and oxoglutarate dehydrogenase, and auxotrophy for thiamine on fermentative carbon sources . These findings highlight the essential role of TPC1 in thiamine metabolism and cellular function.

Research Applications and Significance

Recombinant L. elongisporus TPC1 has several important research applications in biochemistry, molecular biology, and medical research.

Medical Significance

L. elongisporus has emerged as an opportunistic human pathogen, with infections reported in 14 countries across 5 continents . The yeast has been associated with bloodstream infections, oropharyngeal infections, and even infective endocarditis .

Understanding the function of essential proteins such as TPC1 in this organism may provide insights into its metabolism and potential vulnerabilities that could be exploited for therapeutic intervention. Given the essential role of thiamine in cellular metabolism, the mitochondrial thiamine transport system represents a potential target for antifungal drug development.

Biotechnological Applications

L. elongisporus has gained attention for its ability to produce polyunsaturated fatty acids (PUFAs), with recent research demonstrating its capacity to efficiently accumulate lipids and synthesize short-chain PUFAs . The role of mitochondrial metabolism in supporting this capability makes TPC1 a protein of interest for metabolic engineering efforts aimed at enhancing PUFA production.

Future Research Directions

Future research on recombinant L. elongisporus TPC1 may focus on several promising directions:

  1. Detailed structural analysis using X-ray crystallography or cryo-electron microscopy to elucidate the three-dimensional structure and transport mechanism

  2. Investigation of the regulation of TPC1 expression and activity in response to environmental conditions and metabolic demands

  3. Exploration of the role of TPC1 in L. elongisporus pathogenicity and its potential as a target for antifungal therapy

  4. Engineering of TPC1 variants with enhanced transport capabilities to support biotechnological applications such as PUFA production

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
TPC1; LELG_01926; Mitochondrial thiamine pyrophosphate carrier 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Target Names
TPC1
Target Protein Sequence
MSSKHREDHLKRGSDVSPYESLFAGSVSGGVARAITAPLDTIKIRLQLQTKSHKHPHTQK VSALNVVKDLLKNEGVIALWKGNVPAEILYVMYGAVQFTTYSALSKSLSQMEKDYSIVMP SSVHSLLAGVGAGIASTLTTYPFDLLRTRLVANKKKNLLSMTGTFRKILHAEGISGLFAG IRPAMISVASTTGLMFWSYELAREFSSEYKHVPFIEGICGFVAGATSKGITFPLDTLRKR CQIYSEVYGTKYKSSLRIFMNIVSREGVLGLYRGYGVSILKTAPTSAISLWTYEYVISAT RHYRLSKPLV
Uniprot No.

Target Background

Function
Mitochondrial transporter responsible for mediating the uptake of thiamine pyrophosphate (ThPP) into mitochondria.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the mitochondrial thiamine pyrophosphate carrier 1 (TPC1) and what is its function in fungi?

Mitochondrial thiamine pyrophosphate carrier 1 (TPC1) is a member of the mitochondrial carrier family that facilitates the transport of thiamine pyrophosphate (ThPP) across the inner mitochondrial membrane. In yeasts like Saccharomyces cerevisiae, TPC1 (encoded by YGR096w) has been functionally characterized as essential for transporting ThPP from the cytosol into mitochondria . This transport is critical because ThPP serves as an essential cofactor for several mitochondrial enzymes, including alpha-acetolactate synthase (ALS), pyruvate dehydrogenase, and oxoglutarate dehydrogenase (OGDH) .

Although specific characterization of TPC1 in Lodderomyces elongisporus has not been directly reported in the provided literature, it likely performs similar functions given the evolutionary relationship between Lodderomyces and other pathogenic Candida species . This transport function would be particularly significant in L. elongisporus as an emerging fungal pathogen, potentially influencing metabolic activity during infection.

How does TPC1 deletion affect mitochondrial function in yeasts?

Deletion of TPC1 leads to significant mitochondrial dysfunction primarily through depletion of intramitochondrial ThPP. Research in S. cerevisiae has demonstrated that tpc1Δ cells exhibit approximately 8-fold lower ThPP content in mitochondria compared to wild-type cells, while post-mitochondrial supernatant (cytosolic) levels remain relatively unchanged . This selective depletion results in markedly reduced activities of ThPP-dependent mitochondrial enzymes:

  • Alpha-acetolactate synthase (ALS) activity decreases 5-fold in tpc1Δ mitochondria

  • Oxoglutarate dehydrogenase (OGDH) activity decreases 4-fold

  • Adding ThPP to assay mixtures restores both enzyme activities nearly completely

The physiological consequences of these enzyme deficiencies include auxotrophy for branched-chain amino acids (valine and isoleucine) when grown on fermentable carbon sources without thiamine supplementation . This occurs because ALS catalyzes the first step in branched-chain amino acid biosynthesis within mitochondria.

What are the growth characteristics of TPC1-deficient strains?

TPC1-deficient yeast strains exhibit carbon source-dependent growth defects that reveal the essential nature of this transporter under specific metabolic conditions:

  • On fermentable carbon sources (e.g., glucose, galactose) without thiamine supplementation, tpc1Δ cells show severely impaired growth

  • Growth can be restored by adding valine and isoleucine to the medium, bypassing the need for functional ALS

  • On non-fermentable carbon sources (e.g., ethanol), tpc1Δ cells grow normally even without thiamine supplementation

  • This differential growth pattern suggests that mitochondrial ThPP requirements vary significantly depending on the metabolic state of the cell

These growth characteristics provide a useful phenotypic screening method for identifying TPC1 mutations or for complementation studies of putative TPC1 orthologs from other species, including L. elongisporus.

How is TPC1 different from other mitochondrial carriers?

TPC1 possesses several distinguishing characteristics that differentiate it from other mitochondrial carriers:

  • Substrate specificity: TPC1 primarily transports ThPP and thiamine monophosphate (ThMP), with limited transport of structurally related nucleotides, but does not transport thiamine, nucleosides, purines, or pyrimidines

  • Transport mechanism: TPC1 can catalyze both uniport (single substrate movement) and exchange reactions, whereas some carriers like the human deoxynucleotide carrier (DNC) catalyze only obligatory counter-exchange

  • Inhibitor sensitivity: Unlike the adenine nucleotide translocase, TPC1 is not affected by carboxyatractyloside or bongkrekic acid

  • Proton co-transport: TPC1 co-transports substrates with protons in a pH gradient-dependent manner, favoring the uptake of ThPP into energized mitochondria

The human DNC, despite being the closest sequence homolog to yeast TPC1 (25% identity), is functionally distinct and cannot complement tpc1Δ in yeast .

What methods are recommended for recombinant expression and purification of L. elongisporus TPC1?

For recombinant expression and purification of L. elongisporus TPC1, researchers should consider the following methodological approach based on successful protocols used for related mitochondrial carriers:

  • Expression system selection:

    • Bacterial expression in E. coli using a specialized strain like BL21(DE3) or C41(DE3), which are optimized for membrane protein expression

    • Expression as inclusion bodies using a pET vector system with a His-tag for purification

    • Alternative expression in Pichia pastoris may provide more native-like post-translational modifications

  • Protein extraction and purification protocol:

    • Inclusion body isolation by cell lysis and centrifugation

    • Solubilization of inclusion bodies in sarkosyl or other mild detergents

    • Affinity purification using Ni-NTA chromatography

    • Optional: Size exclusion chromatography for higher purity

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • Circular dichroism to assess secondary structure integrity

    • Thermal stability assays to evaluate protein folding

This approach parallels the successful expression of S. cerevisiae TPC1, which was overexpressed in bacteria, purified, and functionally reconstituted into phospholipid vesicles for transport studies .

How can functional reconstitution of L. elongisporus TPC1 be achieved and validated?

Functional reconstitution of L. elongisporus TPC1 can be achieved using liposome-based transport assays following these methodological steps:

  • Liposome preparation:

    • Create liposomes using egg phosphatidylcholine and other phospholipids in a molar ratio that mimics the mitochondrial inner membrane

    • Form liposomes by removing detergent via dialysis or adsorption to Bio-Beads

  • Protein incorporation:

    • Mix purified TPC1 with liposomes at a protein:lipid ratio of approximately 1:50 to 1:100

    • Perform freeze-thaw cycles to enhance protein incorporation

    • Remove external substrate by gel filtration or ion-exchange chromatography

  • Transport assay setup:

    • For uniport measurements: Load liposomes with buffer only and initiate transport by adding labeled substrate externally

    • For exchange measurements: Preload liposomes with unlabeled substrate and initiate transport by adding labeled substrate externally

    • Use radiolabeled substrates (e.g., [14C]ThPP) or fluorescent ThPP analogs

  • Validation methods:

    • Kinetic parameter determination (Km, Vmax) for various substrates

    • Inhibition studies using known mitochondrial carrier inhibitors

    • pH gradient and membrane potential dependency tests

    • Substrate specificity profile comparison with known TPC1 proteins

Success in reconstitution can be confirmed by demonstrating ThPP transport activity with kinetic parameters similar to those reported for S. cerevisiae TPC1, which exhibits high specificity for ThPP and ThMP transport .

What genomic features of L. elongisporus might influence TPC1 function compared to other Candida species?

Analysis of L. elongisporus genomic features reveals several characteristics that might influence TPC1 function compared to other Candida species:

  • Genetic heterozygosity patterns:

    • L. elongisporus exhibits significant genomic diversity and patterns of loss of heterozygosity (LOH) in clinical and environmental isolates

    • Clinical isolates from fungemia outbreaks show distinct genetic profiles compared to environmental isolates

    • These heterozygosity patterns could impact TPC1 gene expression or protein structure

  • Evolutionary relationships:

    • L. elongisporus was initially considered a teleomorph of Candida parapsilosis but is now recognized as a distinct species

    • This phylogenetic positioning suggests TPC1 in L. elongisporus may have unique functional adaptations

  • Recombination frequency:

    • Clinical isolates show evidence of frequent recombination, while environmental isolates (from fruit surfaces) show less recombination

    • Higher recombination rates in clinical settings could drive adaptive evolution of genes including TPC1

  • Triazole resistance-related genes:

    • L. elongisporus strains contain numerous nonsynonymous SNPs in triazole resistance-related genes

    • Some of these resistance mechanisms might indirectly affect mitochondrial function and TPC1 activity

These genomic features suggest that TPC1 function in L. elongisporus may be subject to greater evolutionary plasticity in clinical environments, potentially contributing to its emergence as a pathogen.

How might TPC1 contribute to the pathogenicity and antifungal resistance of L. elongisporus?

TPC1 could contribute to L. elongisporus pathogenicity and antifungal resistance through several mechanisms:

  • Metabolic adaptation during infection:

    • Efficient ThPP transport via TPC1 ensures optimal activity of key mitochondrial enzymes required for energy production and biosynthesis during infection

    • This metabolic flexibility could facilitate adaptation to the nutrient-limited host environment

  • Stress response coordination:

    • Proper mitochondrial function, supported by TPC1 activity, is crucial for cellular responses to various stresses encountered during infection

    • The ability to maintain mitochondrial homeostasis could enhance survival within host tissues

  • Potential link to antifungal resistance:

    • L. elongisporus clinical isolates exhibit nonsynonymous SNPs in 24 triazole resistance-related genes

    • Mitochondrial function has been implicated in azole resistance in other Candida species

    • TPC1-mediated metabolic adaptations could potentially contribute to resistance mechanisms

  • Environmental persistence:

    • L. elongisporus from clinical environments shows resistance to sodium hypochlorite (1%) disinfectants, with environmental isolates maintaining viability after exposure

    • Enhanced mitochondrial function through efficient ThPP transport might contribute to this disinfectant tolerance

The following table summarizes potential relationships between TPC1 function and L. elongisporus virulence factors:

TPC1-dependent processPotential contribution to pathogenicityExperimental evidence in related species
ThPP-dependent enzyme activityEnergy production, biosynthetic capacityReduced ALS and OGDH activity in tpc1Δ S. cerevisiae
Branched-chain amino acid synthesisGrowth in nutrient-limited host environmentsAuxotrophy for valine and isoleucine in tpc1Δ S. cerevisiae
Mitochondrial stress responseResistance to host immune defensesNot directly shown, but inferred from mitochondrial roles
Metabolic flexibilityAdaptation to changing host nichesCarbon source-dependent growth phenotypes
Biofilm formationAdherence to medical devices, host tissuesPotential target for investigation in L. elongisporus

What experimental approaches can be used to study the in vivo function of TPC1 in L. elongisporus?

Multiple experimental approaches can be employed to study the in vivo function of TPC1 in L. elongisporus:

  • Gene deletion and complementation:

    • CRISPR-Cas9 or traditional homologous recombination to generate TPC1 knockout strains

    • Heterologous complementation with TPC1 from other species to assess functional conservation

    • Site-directed mutagenesis of conserved residues to identify functional domains

  • Fluorescence-based localization and interaction studies:

    • GFP-tagging of TPC1 to confirm mitochondrial localization

    • Split-GFP or FRET approaches to identify protein-protein interactions

    • Live-cell imaging to track dynamics during different growth conditions or stresses

  • Metabolomic profiling:

    • Comparative analysis of wild-type and TPC1-mutant strains to identify metabolic alterations

    • Measurement of ThPP levels in different cellular compartments using HPLC or LC-MS

    • Isotope labeling experiments to track thiamine metabolism

  • Transcriptomic and proteomic analyses:

    • RNA-seq to identify genes differentially expressed in TPC1 mutants

    • Proteomics to detect changes in mitochondrial protein composition

    • ChIP-seq to investigate potential regulatory mechanisms controlling TPC1 expression

  • Virulence assays:

    • Infection models using Galleria mellonella larvae or murine systems

    • Biofilm formation capacity comparison between wild-type and TPC1 mutants

    • Phagocytosis assays to assess interaction with host immune cells

These approaches would provide complementary insights into TPC1 function in L. elongisporus, potentially revealing its importance in metabolism, stress response, and pathogenicity.

What are the best methods for measuring ThPP transport activity in isolated mitochondria?

Measuring ThPP transport activity in isolated mitochondria from L. elongisporus requires specialized techniques:

  • Mitochondrial isolation protocol:

    • Enzymatic digestion of fungal cell wall using zymolyase or glucanases

    • Gentle mechanical disruption using glass beads or Dounce homogenization

    • Differential centrifugation to obtain a purified mitochondrial fraction

    • Confirmation of mitochondrial integrity via respiratory control ratio or membrane potential measurements

  • Transport assay options:

    • Direct measurement using radiolabeled [14C]ThPP uptake into isolated mitochondria

    • Indirect measurement via ThPP-dependent enzyme activities (ALS and OGDH) before and after incubation with external ThPP

    • ThPP quantification using HPLC with fluorescence detection following derivatization

  • Analytical considerations:

    • Time-course measurements to determine initial rates

    • Concentration series to determine kinetic parameters

    • Inhibitor studies using mitochondrial uncouplers or specific transport inhibitors

    • Controls for non-specific binding and diffusion

The respiratory control ratio and mitochondrial membrane potential are crucial quality control parameters that must be monitored throughout the experiments to ensure the functional integrity of the isolated mitochondria.

How can recombinant L. elongisporus TPC1 be characterized for structure-function relationships?

Characterizing structure-function relationships in recombinant L. elongisporus TPC1 requires a multi-faceted approach:

  • Sequence-based analyses:

    • Multiple sequence alignment with other mitochondrial carriers to identify conserved motifs

    • Prediction of transmembrane domains and substrate binding sites

    • Homology modeling based on available mitochondrial carrier structures

  • Mutagenesis strategies:

    • Alanine-scanning mutagenesis of conserved residues in transmembrane domains

    • Charge reversal mutations at putative substrate binding sites

    • Chimeric constructs with other mitochondrial carriers to identify functional domains

  • Functional assays for mutant proteins:

    • Reconstitution into liposomes for transport activity measurements

    • Complementation of tpc1Δ S. cerevisiae to assess in vivo functionality

    • Binding assays using isothermal titration calorimetry or microscale thermophoresis

  • Structural analysis attempts:

    • Crystallization trials for X-ray diffraction studies

    • Cryo-electron microscopy for structure determination

    • Hydrogen-deuterium exchange mass spectrometry to probe dynamics and accessibility

By systematically altering TPC1 structure and measuring functional consequences, researchers can map crucial residues for substrate recognition, binding, and translocation across the mitochondrial inner membrane.

What analytical methods should be used to quantify intracellular and mitochondrial ThPP levels?

Accurate quantification of ThPP in subcellular compartments requires sensitive and specific analytical techniques:

  • Sample preparation protocols:

    • Rapid quenching of metabolism using cold methanol or perchloric acid

    • Subcellular fractionation to separate mitochondria from cytosol

    • Extraction of ThPP using perchloric acid followed by neutralization

    • Sample cleanup using solid-phase extraction or ion-exchange

  • Analytical techniques:

    • HPLC with fluorescence detection after thiochrome derivatization

    • LC-MS/MS for higher specificity and sensitivity

    • Capillary electrophoresis with UV detection as an alternative approach

  • Quantification strategies:

    • External calibration with ThPP standards

    • Internal standardization with isotopically labeled ThPP

    • Matrix-matched calibration to account for extraction efficiency

  • Data normalization methods:

    • Protein content of subcellular fractions

    • Mitochondrial marker enzymes (citrate synthase)

    • Cell number or dry weight for whole-cell measurements

Using these approaches, researchers have demonstrated that tpc1Δ S. cerevisiae cells exhibit approximately 8-fold lower ThPP levels in mitochondria compared to wild-type, while cytosolic levels remain relatively unchanged .

How does TPC1 in L. elongisporus compare to orthologous transporters in other fungal pathogens?

While direct comparative data for L. elongisporus TPC1 is limited, general evolutionary patterns can be inferred:

Analysis of genetic diversity in L. elongisporus clinical isolates revealed significant recombination and persistence in hospital settings , which may drive functional adaptations in metabolically important proteins like TPC1.

What factors influence TPC1 expression and regulation in different environmental conditions?

The regulation of TPC1 expression likely responds to multiple environmental signals:

  • Carbon source effects:

    • TPC1 function is more critical during growth on fermentable carbon sources (glucose, galactose) than on non-fermentable sources (ethanol)

    • This suggests potential glucose-responsive regulatory elements in the promoter region

  • Thiamine availability:

    • Unlike genes involved in thiamine biosynthesis, TPC1 expression in S. cerevisiae is not repressed by thiamine addition

    • This constitutive expression pattern ensures mitochondrial ThPP availability regardless of external thiamine levels

  • Stress response integration:

    • L. elongisporus clinical isolates show adaptation to hospital environments, including resistance to disinfectants

    • Stress response pathways may regulate mitochondrial function, potentially including TPC1 expression

  • Host adaptation signals:

    • During infection, pathogens must adapt to nutrient limitations and host defenses

    • TPC1 regulation might respond to infection-relevant signals like iron limitation or oxidative stress

A comprehensive analysis of TPC1 expression under various conditions would require transcriptomic approaches combined with reporter gene assays to identify key regulatory elements controlling its expression.

Could TPC1 serve as a potential antifungal target for L. elongisporus infections?

TPC1 presents several characteristics that make it a potentially attractive antifungal target:

  • Essential metabolic function:

    • TPC1 deficiency causes growth defects under specific conditions by limiting ThPP availability to essential mitochondrial enzymes

    • Inhibitors could potentially exploit this metabolic dependency

  • Structural considerations:

    • Mitochondrial carriers have unique structural features that could allow selective targeting

    • Differences between fungal and human orthologs might permit development of selective inhibitors

  • Therapeutic window assessment:

    • The human homolog (25% identity) cannot complement the yeast tpc1Δ mutant

    • This functional divergence suggests potential for selective inhibition

  • Resistance development risk:

    • L. elongisporus shows genomic plasticity and adaptation to hospital environments

    • Resistance mechanisms would need to be considered in target validation

The following considerations would be important for validating TPC1 as a drug target:

  • Essential nature under infection-relevant conditions

  • Structural characterization to enable rational inhibitor design

  • Selectivity over human mitochondrial carriers

  • Synergy with existing antifungals

How might TPC1 contribute to the persistence of L. elongisporus in hospital environments?

The persistence of L. elongisporus in hospital environments may be influenced by TPC1-dependent processes:

  • Disinfectant resistance:

    • Clinical and environmental L. elongisporus isolates show resistance to 1% sodium hypochlorite

    • SEM analysis revealed that these strains maintained cellular integrity after disinfectant exposure

    • Efficient mitochondrial function, supported by TPC1, could contribute to stress tolerance

  • Metabolic flexibility:

    • TPC1 ensures appropriate ThPP levels for mitochondrial enzymes under various conditions

    • This metabolic adaptability could facilitate survival on diverse nutrient sources in hospital settings

  • Biofilm formation potential:

    • Although not directly studied for L. elongisporus TPC1, mitochondrial function often influences biofilm development in other fungi

    • Biofilms contribute to persistence on medical devices and surfaces

  • Genetic adaptation:

    • L. elongisporus clinical isolates show evidence of high rates of evolution and recombination

    • TPC1 variants could potentially emerge that enhance survival in hospital environments

Understanding these persistence mechanisms could inform improved infection control strategies for managing L. elongisporus outbreaks, particularly in vulnerable settings like NICUs where outbreaks have been reported .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.