Recombinant Lodderomyces elongisporus NADH-cytochrome b5 reductase 2 (MCR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if different. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.

Tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
MCR1; LELG_04814; NADH-cytochrome b5 reductase 2; Mitochondrial cytochrome b reductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) (Yeast) (Saccharomyces elongisporus)
Target Names
MCR1
Target Protein Sequence
MSVSRLFSNPKFVYPLVGATIGSIGLAYYSTQAQFYIANETGKTFTGGDQWIDLKLKKSE DLTHNTKHLTFELLNPDDVSGLITASMLMTKYVTPKGNNVIRPYTPVSDPDQKGTLDFVI KRYENGKMSNHIHNLKEGETLSFKGPVVKWKWEPNQFKSIALIGGGTGITPLYQLLREIT SNPEDKTKVSLIYGNTSPEDVLIKDRIDDIAAKHKDQVKVTYFVDENKATKDWEGEVGFI TKEFLEKELDKPSPDFKIFVCGPPGLYKAISGVKVSPTDQGEVEGALKDLGFSKEHVFKF
Uniprot No.

Target Background

Function

May mediate the reduction of outer membrane cytochrome b5.

Database Links
Protein Families
Flavoprotein pyridine nucleotide cytochrome reductase family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.

Q&A

What is Lodderomyces elongisporus and why is it significant for MCR1 research?

Lodderomyces elongisporus is a diploid ascomycete yeast that has attracted increasing attention due to its emergence as a human fungal pathogen. Initially discovered as Saccharomyces elongisporus in 1952 from Californian citrus concentrate, this yeast has since been isolated from diverse sources including soil, fermented food products, plants, stored apples, pigeon excreta, insects, marine fish, hospital environments, and humans . Its medical relevance was first noted in 2008 when a retrospective analysis of 542 clinical Candida parapsilosis isolates from 25 countries revealed that ten isolates were actually L. elongisporus .

L. elongisporus was previously confused with Candida parapsilosis, but molecular studies have clearly differentiated it as a distinct species. The genome size of L. elongisporus (15-16 Mb) is slightly larger than that of C. parapsilosis (12-13 Mb) but comparable to other common human pathogenic Candida species . Understanding the biochemical pathways in this organism, including the role of MCR1, helps researchers investigate its pathogenicity mechanisms and potential therapeutic targets.

How is NADH-cytochrome b5 reductase localized in cells?

NADH-cytochrome b5 reductase and cytochrome b5 are integral membrane proteins with cytosolic active domains and short membrane anchors, which are inserted post-translationally into their target membranes . They are produced as different isoforms with distinct localizations in cells.

In mammalian cells (such as rat), the reductase gene generates two transcripts through an alternative promoter mechanism:

  • A ubiquitous mRNA coding for the myristylated membrane-bound form

  • An erythroid mRNA which generates both the soluble form and a nonmyristylated membrane-binding form

The ubiquitous myristylated form binds to the cytosolic face of both outer mitochondrial membranes and endoplasmic reticulum (ER). For cytochrome b5, two genes code for two homologous forms—one found on outer mitochondrial membranes and the other on the ER . This subcellular distribution is important for understanding the enzyme's function within different cellular compartments.

How does MCR1 contribute to oxidative stress resistance in yeast?

MCR1 plays a critical role in oxidative stress resistance through multiple mechanisms:

  • Free radical scavenging: In S. cerevisiae, MCR1 functions as NADH-D-erythroascorbyl free radical reductase, helping maintain levels of D-erythroascorbic acid, which serves as an antioxidant similar to ascorbic acid (vitamin C) .

  • Direct protective effects: Experimental evidence shows that mcr1 disruptant cells were hypersensitive to hydrogen peroxide and menadione, while overexpression of MCR1 made cells more resistant against oxidative stress .

  • Connection to D-erythroascorbic acid pathway: When MCR1 was disrupted in S. cerevisiae, the intracellular level of D-erythroascorbic acid decreased to approximately 11% of that found in wild-type strains. Conversely, in transformant cells carrying MCR1 in multicopy plasmids, the intracellular level of D-erythroascorbic acid increased up to 1.7-fold .

Research methodology to study this function typically involves:

  • Gene disruption experiments (inserting marker genes like URA3 into the MCR1 gene)

  • Overexpression studies using multicopy plasmids

  • Measuring NADH-D-erythroascorbyl free radical reductase activity

  • Quantifying intracellular D-erythroascorbic acid levels

  • Challenging cells with oxidative stressors (H₂O₂, menadione) and measuring survival

What is the role of MCR1 in hydrolysate inhibitor tolerance during bioethanol production?

Studies have demonstrated that MCR1 overexpression improves tolerance to lignocellulosic hydrolysate inhibitors in S. cerevisiae strains used for bioethanol production . Key findings include:

  • Enhanced hexose metabolism: Overexpression of MCR1 in an industrial S. cerevisiae strain resulted in faster hexose catabolism during fermentation of undiluted and undetoxified spruce hydrolysate .

  • Furaldehyde reduction: The improved phenotype appeared to be related, at least in part, to faster furaldehyde reduction capacity, indicating that this reductase may have a wider substrate range than previously reported .

  • Protection against specific inhibitors: The effect seen by MCR1 overexpression in the presence of acetic acid could be similar to the effect obtained with the biosynthesis of ascorbic acid (ASC), which confers increased resistance to H₂O₂, low pH, and organic acids .

  • Mitochondrial protection: Given the specific mitochondrial location of this enzyme, results support previous observations that indicated a damaging effect of hydrolysate-derived inhibitors to the mitochondria .

Experimental approaches to study this function include:

  • Genetic engineering of industrial yeast strains to overexpress MCR1

  • Fermentation experiments with lignocellulosic hydrolysates

  • Measurement of furaldehyde reduction rates

  • Comparative analysis of hexose and pentose sugar metabolism in wild-type vs. engineered strains

How do different expression systems affect the functionality of recombinant Lodderomyces elongisporus MCR1?

When producing recombinant Lodderomyces elongisporus NADH-cytochrome b5 reductase 2 (MCR1), the choice of expression system can significantly impact protein functionality:

  • E. coli expression: Recombinant full-length Lodderomyces elongisporus MCR1 can be successfully expressed in E. coli with an N-terminal His-tag . This system allows for high protein yields, but potential issues include:

    • Lack of post-translational modifications

    • Formation of inclusion bodies requiring refolding

    • Challenges with membrane-associated domains

  • Yeast expression systems: Expression in S. cerevisiae or other yeast hosts may provide more native-like processing:

    • Proper folding environment

    • More appropriate post-translational modifications

    • Potential for functional studies in a related host organism

  • Mammalian expression: For certain applications requiring mammalian-specific interactions or modifications, mammalian cell systems might be preferred.

When evaluating expression systems, researchers should consider:

  • Required protein yield

  • Need for post-translational modifications

  • Downstream applications (structural studies, functional assays, etc.)

  • Ease of purification

  • Cost and technical constraints

What are the recommended methods for purification of recombinant Lodderomyces elongisporus MCR1?

Purification of recombinant Lodderomyces elongisporus NADH-cytochrome b5 reductase 2 typically follows these steps:

  • Expression system preparation:

    • Most commonly, the protein is expressed in E. coli with an N-terminal His-tag

    • The full-length protein (300 amino acids) or specific domains can be expressed depending on research needs

  • Affinity chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resins to capture His-tagged protein

    • Wash steps with increasing imidazole concentrations to remove non-specifically bound proteins

    • Elution with high imidazole buffer

  • Secondary purification:

    • Ion exchange chromatography (typically anion exchange)

    • Size exclusion chromatography for final polishing and buffer exchange

  • Quality control:

    • SDS-PAGE analysis (expect >90% purity)

    • Western blot confirmation

    • Activity assays specific to NADH-cytochrome b5 reductase

  • Storage recommendations:

    • Store at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Avoid repeated freeze-thaw cycles

    • Can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening

    • Reconstitute protein in deionized sterile water to 0.1-1.0 mg/mL

    • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage

How can researchers accurately measure MCR1 enzyme activity in different experimental systems?

Measuring MCR1 enzyme activity requires specific assays depending on the substrate and experimental context:

  • NADH-cytochrome b5 reductase activity:

    • Monitor the rate of NADH oxidation spectrophotometrically at 340 nm

    • Reaction mixture typically contains cytochrome b5, NADH, and buffer

    • Calculate activity based on the extinction coefficient of NADH (6,220 M⁻¹cm⁻¹)

  • NADH-D-erythroascorbyl free radical reductase activity:

    • This specifically measures the ability to reduce D-erythroascorbyl free radicals

    • Can be measured by EPR spectroscopy or by coupling to D-erythroascorbic acid formation

    • Important for understanding the role in oxidative stress resistance

  • Furaldehyde reduction capacity:

    • Particularly relevant for bioethanol research

    • Measure the conversion of furaldehydes (HMF, furfural) to their corresponding alcohols

    • Can be analyzed by HPLC or spectrophotometric methods

  • In vivo assessment in yeast models:

    • Compare wild-type, MCR1-disrupted, and MCR1-overexpressing strains

    • Measure D-erythroascorbic acid levels in cells

    • Challenge cells with oxidative stressors and measure survival rates

    • Monitor fermentation performance in hydrolysate media

  • Comparative analysis table:

Assay TypePrincipleKey ReagentsDetection MethodApplication
NADH oxidationMeasures NADH consumptionNADH, cytochrome b5, bufferSpectrophotometry (340 nm)Basic enzyme kinetics
D-erythroascorbyl radical reductionMeasures radical scavengingD-erythroascorbyl radical, NADHEPR spectroscopyOxidative stress studies
Furaldehyde reductionMeasures conversion of aldehydes to alcoholsHMF, furfural, NADHHPLCBioethanol production research
Oxidative stress resistanceMeasures cellular protectionH₂O₂, menadioneCell survival assaysPhysiological role of MCR1

What are the best approaches for studying the in vivo interactions of MCR1 in Lodderomyces elongisporus?

Studying in vivo interactions of MCR1 in Lodderomyces elongisporus requires specialized approaches due to the emerging nature of this pathogen and its unique characteristics:

  • Gene manipulation techniques:

    • CRISPR-Cas9 systems adapted for Lodderomyces elongisporus

    • Homologous recombination-based gene deletion/modification

    • Tetracycline-regulated gene expression systems

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with tagged MCR1

    • Yeast two-hybrid screening using MCR1 as bait

    • Proximity labeling approaches (BioID, APEX)

    • Split-GFP complementation assays

  • Subcellular localization:

    • Fluorescent protein tagging of MCR1

    • Immunofluorescence microscopy

    • Subcellular fractionation and Western blotting

    • Comparative analysis with other yeast species to identify conserved patterns

  • Physiological relevance:

    • Correlation of MCR1 activity with oxidative stress resistance

    • Role in pathogenicity using infection models

    • Transcriptional profiling under different stress conditions

  • Comparative genomics approach:

    • Compare MCR1 function across related species (L. elongisporus, C. parapsilosis, S. cerevisiae)

    • Identify conserved interaction partners and regulatory mechanisms

    • Cross-species complementation studies to determine functional conservation

The unique properties of L. elongisporus (such as its ability to form ascospores and its emerging role as a pathogen) should be considered when designing experiments to study MCR1 function in this organism .

How does MCR1 function potentially contribute to Lodderomyces elongisporus pathogenicity?

While direct evidence linking MCR1 to Lodderomyces elongisporus pathogenicity is limited, several mechanisms can be hypothesized based on known functions and related research:

  • Oxidative stress resistance:

    • MCR1's role in protecting against oxidative stress could enhance survival within host immune cells

    • Neutrophils and macrophages produce reactive oxygen species as a defense mechanism

    • Enhanced antioxidant capabilities may help L. elongisporus evade this host defense

  • Survival in hospital environments:

    • L. elongisporus has been shown to survive in hospital environments, with cases suggesting hospital-acquired infections

    • Resistance to environmental stressors, potentially enhanced by MCR1 function, could contribute to this persistence

  • Biofilm formation:

    • Although limited, biofilm formation has been observed in some clinical L. elongisporus strains

    • Strains have been isolated from catheter tips, suggesting biofilm capability in vivo

    • Potential role of MCR1 in supporting cellular metabolism during biofilm formation

  • Metabolic adaptation:

    • MCR1's involvement in redox metabolism may help the organism adapt to different host niches

    • The ability to utilize diverse carbon sources and adapt to changing environments is crucial for pathogenicity

Cases of L. elongisporus infections have been reported worldwide, with clinical presentations including fungemia, catheter-tip infections, endocarditis, and meningitis . Understanding the molecular basis of its pathogenicity, including potential contributions from MCR1, could lead to improved diagnostic and therapeutic approaches.

Can MCR1 be targeted for antifungal development against Lodderomyces elongisporus?

The potential of MCR1 as an antifungal target requires careful consideration of several factors:

  • Target validation evidence:

    • Studies in S. cerevisiae show that MCR1 disruption leads to increased sensitivity to oxidative stress

    • This suggests MCR1 inhibition could potentially sensitize fungi to oxidative damage or immune clearance

  • Drug development considerations:

    • Substrate binding sites or enzyme active sites could serve as targeting points

    • Structure-based drug design would require detailed structural information on L. elongisporus MCR1

    • In silico screening against MCR1 models could identify potential inhibitor candidates

  • Challenges and limitations:

    • MCR1 homologs exist in human cells, raising specificity concerns

    • Potential for off-target effects on human NADH-cytochrome b5 reductase

    • Need for selective targeting of fungal-specific features

  • Alternative approaches:

    • Targeting MCR1 in combination with existing antifungals

    • Exploiting differences between fungal and human isoforms

    • Developing inhibitors that specifically target the mitochondrial form

  • Current antifungal susceptibility data:
    L. elongisporus has shown varying susceptibility profiles in clinical isolates. For example, MIC values (μg/mL) reported in one study were: amphotericin B, 0.012; fluconazole, 0.125; voriconazole, 0.004; posaconazole, 0.003; itraconazole, 0.008; flucytosine, 0.064; caspofungin, 0.064; micafungin, 0.003 . Understanding how MCR1 inhibition might affect these susceptibility patterns would be important for drug development.

What are the most promising research directions for understanding MCR1 function across different yeast species?

Future research on MCR1 across yeast species could focus on several promising directions:

  • Comparative functional genomics:

    • Systematic comparison of MCR1 function across pathogenic and non-pathogenic yeasts

    • Cross-species complementation studies to identify species-specific functions

    • Evolutionary analysis to understand functional divergence of MCR1

  • Systems biology approaches:

    • Integration of proteomics, metabolomics, and transcriptomics to map MCR1's role in cellular networks

    • Flux balance analysis to quantify the impact of MCR1 on cellular metabolism

    • Network modeling to predict the effects of MCR1 modulation

  • Structure-function relationships:

    • High-resolution structural studies of MCR1 from different yeast species

    • Identification of catalytic domains and species-specific structural features

    • Rational design of specific inhibitors based on structural differences

  • Expanded substrate specificity studies:

    • Investigation of the wider substrate range suggested by bioethanol research

    • Systematic screening of potential substrates beyond cytochrome b5

    • Metabolic profiling of wild-type vs. MCR1-deficient strains

  • Technological developments:

    • Development of high-throughput screening methods for MCR1 activity

    • Creation of biosensors to monitor MCR1 activity in vivo

    • Application of CRISPR technologies for precise genome engineering in pathogenic yeasts

These research directions would not only enhance our understanding of this important enzyme but could also lead to biotechnological applications and potential therapeutic strategies for fungal infections.

How can researchers design experiments to resolve contradictory findings about MCR1 function?

When addressing contradictory findings about MCR1 function, researchers should consider the following experimental design strategies:

  • Standardization of experimental conditions:

    • Use consistent strains, media compositions, and growth conditions

    • Standardize protein expression and purification protocols

    • Develop consensus assay methods for measuring MCR1 activity

  • Comprehensive phenotypic profiling:

    • Perform parallel phenotypic analyses under identical conditions

    • Use high-dimensional phenotyping approaches (growth, metabolism, stress resistance)

    • Quantify phenotypes across multiple environmental conditions

  • Genetic background considerations:

    • Test MCR1 function in multiple genetic backgrounds

    • Use isogenic strains differing only in MCR1 status

    • Consider strain-specific genetic modifiers

  • Conditional and tissue-specific approaches:

    • Employ conditional expression systems to study acute vs. chronic effects

    • Use cell-type or organelle-specific targeting to dissect compartmentalized functions

    • Develop inducible promoter systems for temporal control

  • Multi-omics integration:

    • Combine transcriptomic, proteomic, and metabolomic analyses

    • Map contextual differences that might explain conflicting results

    • Use network analysis to identify condition-specific functional modules

  • Cross-validation across species:

    • Test hypotheses in multiple yeast species (S. cerevisiae, L. elongisporus, C. albicans)

    • Develop heterologous expression systems for comparative analysis

    • Perform complementation studies to assess functional conservation

  • Proposed experimental workflow:

    a. Identify specific contradictions in the literature
    b. Design experiments testing multiple hypotheses simultaneously
    c. Include appropriate controls and reference standards
    d. Use quantitative rather than qualitative measurements
    e. Apply statistical methods appropriate for multi-factorial experiments
    f. Share detailed protocols and raw data to enable reproducibility

By systematically addressing potential sources of experimental variation and employing rigorous controls, researchers can resolve contradictory findings and establish a more coherent understanding of MCR1 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.