Recombinant Loligo bleekeri NADH-ubiquinone oxidoreductase chain 3 (ND3)

What is Loligo bleekeri NADH-ubiquinone oxidoreductase chain 3 (ND3)?

Loligo bleekeri NADH-ubiquinone oxidoreductase chain 3 (ND3) is a mitochondrial membrane protein encoded by the ND3 gene. It functions as a subunit of Complex I in the electron transport chain with EC classification 1.6.5.3. This protein is found in Bleeker's squid (Doryteuthis bleekeri) and consists of 117 amino acids with the sequence: MVTILIYLLILLIINVVLLLLGLIINKRSYSDREKNSPFECGFDPSIHTRAPFSMRFFLL AVIFLIFDVEIILLLPLTSNILNSNTHWPLTSSMIFLTILLIGLFHEWNQGSLDWMK . ND3 is one of several subunits that collectively form the NADH-ubiquinone oxidoreductase complex essential for cellular respiration and energy production.

How does ND3 function in the respiratory chain of Loligo bleekeri?

ND3 functions as an integral component of Complex I (NADH-ubiquinone oxidoreductase) in the mitochondrial respiratory chain. Similar to other NADH dehydrogenase subunits, it participates in electron transfer from NADH to ubiquinone (coenzyme Q), coupled with proton pumping across the inner mitochondrial membrane. This process contributes to establishing the electrochemical gradient used for ATP synthesis. The hydrophobic nature of its amino acid sequence suggests ND3 is embedded within the membrane domain of Complex I, potentially contributing to proton translocation or maintaining structural integrity of the complex .

What is the relationship between ND3 and other NADH-ubiquinone oxidoreductase subunits?

ND3 is one of multiple subunits that comprise the NADH-ubiquinone oxidoreductase complex. In Loligo bleekeri, other related subunits include ND6 (chain 6), which consists of 168 amino acids . These subunits work coordinately to facilitate electron transfer and proton pumping. While ND3 is significantly smaller (117 amino acids) compared to ND6 (168 amino acids), both contain multiple membrane-spanning regions as evidenced by their hydrophobic amino acid sequences . The functional integration of these subunits creates a complete Complex I capable of efficiently coupling electron transfer with proton translocation.

What are optimal storage and handling conditions for recombinant Loligo bleekeri ND3?

For optimal preservation of recombinant Loligo bleekeri ND3, the protein should be stored in a Tris-based buffer containing 50% glycerol at -20°C. For extended storage periods, maintaining the protein at -80°C is recommended. To minimize protein degradation from repeated freeze-thaw cycles, it is advisable to create working aliquots that can be stored at 4°C for up to one week . When preparing working solutions, gentle mixing rather than vortexing is recommended to prevent protein denaturation. Additionally, maintaining reducing conditions may be beneficial for preserving structural integrity of cysteine-containing regions in the protein.

How can I design experiments to identify the ubiquinone binding site in Loligo bleekeri ND3?

To identify the ubiquinone binding site in Loligo bleekeri ND3, photoaffinity labeling with photoreactive ubiquinone analogs represents an effective approach. Based on methods applied to similar proteins, the following protocol can be adapted:

• Synthesize photoreactive biotinylated ubiquinone mimics with minimal modifications to the quinone ring structure

• Incubate purified recombinant ND3 with the photoaffinity probe

• Activate cross-linking through UV irradiation

• Digest the cross-linked protein with appropriate proteases (CNBr, V8 protease, or lysylendopeptidase)

• Purify biotinylated peptides using streptavidin-agarose

• Identify cross-linked peptides through mass spectrometry

This approach has been successfully applied to identify ubiquinone binding sites in related proteins such as the Ndi1 enzyme from Saccharomyces cerevisiae, where it revealed specific binding regions . When adapting this method for Loligo bleekeri ND3, consideration should be given to the protein's hydrophobicity and membrane association.

What analytical techniques are most effective for characterizing recombinant ND3 structure and function?

For comprehensive characterization of recombinant Loligo bleekeri ND3, multiple complementary analytical techniques should be employed:

These techniques provide complementary structural and functional information when traditional crystallographic approaches prove challenging due to the membrane-associated nature of ND3 .

How can transcriptome analysis techniques be applied to study ND3 expression patterns?

Transcriptome analysis can be applied to study ND3 expression patterns in Loligo bleekeri using RNA-sequencing approaches adapted from similar studies in other species. Based on methodologies employed for Triplophysa species, the following workflow is recommended:

• Extract high-quality RNA from relevant tissues (e.g., muscle, gill, brain)

• Prepare RNA-seq libraries following standard protocols

• Perform paired-end sequencing (≥125 bp read length) to generate approximately 50-85 million clean reads per sample

• Assemble transcripts using de novo assembly software

• Identify protein-coding transcripts using TransDecoder

• Clean assembled transcripts using software like CroCo to remove potential contamination

• Quantify expression levels using RSEM with Bowtie2 for read mapping

• Perform differential expression analysis using edgeR or similar software

This approach enables identification of tissue-specific expression patterns and potential regulatory mechanisms controlling ND3 expression . When comparing expression levels between tissues or experimental conditions, scaling normalized factors should be used to adjust read counts for accurate comparison.

What approaches can be used to study evolutionary conservation of ND3 across cephalopod species?

To study evolutionary conservation of ND3 across cephalopod species, multiple bioinformatic approaches can be integrated:

• Sequence Alignment and Phylogenetic Analysis:

  • Collect ND3 sequences from multiple cephalopod species

  • Perform multiple sequence alignment using MUSCLE or MAFFT

  • Construct phylogenetic trees using maximum likelihood or Bayesian methods

  • Calculate evolutionary distances between sequences

• Selection Pressure Analysis:

  • Calculate nonsynonymous (dN) and synonymous (dS) substitution rates

  • Determine dN/dS ratios to identify regions under positive, neutral, or purifying selection

  • Apply methods similar to those used in the Triplophysa study, using paml-codeml for calculation of substitution rates

  • Exclude sequences with Ks values >2 to avoid false alignments or pseudogenes

• Functional Domain Conservation:

  • Identify conserved functional domains across species

  • Map conservation onto predicted structural models

  • Compare conservation patterns in membrane-spanning versus loop regions

This comprehensive approach provides insights into evolutionary constraints on ND3 structure and function across cephalopod evolution.

How can site-directed mutagenesis be used to investigate functional residues in Loligo bleekeri ND3?

Site-directed mutagenesis represents a powerful approach for investigating functional residues in Loligo bleekeri ND3. Based on the amino acid sequence provided (MVTILIYLLILLIINVVLLLLGLIINKRSYSDREKNSPFECGFDPSIHTRAPFSMRFFLL AVIFLIFDVEIILLLPLTSNILNSNTHWPLTSSMIFLTILLIGLFHEWNQGSLDWMK) , several target sites can be prioritized:

• Charged residues within hydrophobic regions: Mutations of charged residues (K, R, E, D) embedded within transmembrane domains can reveal their role in proton translocation.

• Conserved cysteine residues: The cysteine within the sequence (SPFECGFDP) may participate in disulfide bonding or metal coordination. Mutation to serine can assess its functional importance.

• Species-specific variations: Comparing sequences across species can identify unique residues for targeted mutagenesis.

The mutated constructs should be expressed in appropriate systems (bacterial or eukaryotic), purified, and characterized using activity assays and structural analyses to determine how specific mutations affect protein function, stability, and complex assembly.

What methodologies can be employed to study interactions between ND3 and other respiratory complex components?

To investigate interactions between ND3 and other respiratory complex components, several complementary approaches can be employed:

• Co-immunoprecipitation (Co-IP):

  • Develop specific antibodies against Loligo bleekeri ND3

  • Solubilize mitochondrial membranes using mild detergents

  • Perform immunoprecipitation and identify interacting partners by mass spectrometry

• Chemical Cross-linking coupled with Mass Spectrometry (XL-MS):

  • Treat isolated respiratory complexes with membrane-permeable cross-linkers

  • Digest cross-linked complexes and analyze by specialized MS/MS

  • Identify inter-protein cross-links to map interaction interfaces

• Blue Native PAGE:

  • Separate intact respiratory complexes under native conditions

  • Identify complex composition through second-dimension SDS-PAGE

  • Analyze complex stability with different detergents and conditions

• Proximity Labeling:

  • Generate fusion constructs with enzymes like BioID or APEX2

  • Express in appropriate systems and identify proximal proteins

  • Map the interaction network surrounding ND3

These methodologies provide complementary data about static and dynamic interactions involving ND3 within the respiratory complex architecture.

How can enzymatic assays be designed to measure specific activity of recombinant Loligo bleekeri ND3?

Designing enzymatic assays for recombinant Loligo bleekeri ND3 requires consideration of its function within Complex I. The following approaches can be implemented:

• NADH:Ubiquinone Oxidoreductase Activity Assay:

  • Monitor the decrease in NADH absorbance at 340 nm

  • Use ubiquinone-1 (UQ1) or ubiquinone-2 (UQ2) as electron acceptors

  • Calculate activity as μmol NADH oxidized/min/mg protein

• Electron Transfer to Artificial Acceptors:

  • Measure electron transfer to artificial acceptors like potassium ferricyanide

  • Compare rates with physiological electron acceptors

• Inhibitor Sensitivity Profiling:

  • Test sensitivity to known Complex I inhibitors (rotenone, piericidin A)

  • Generate IC50 values for various inhibitors

  • Compare inhibition profiles with other species

• Reconstitution Assays:

  • Incorporate recombinant ND3 into proteoliposomes

  • Measure proton pumping using pH-sensitive fluorescent dyes

  • Assess membrane potential generation

These assays should be performed under controlled temperature conditions (typically 25-30°C) with appropriate controls to ensure specificity and reliability of the measurements.

What are common difficulties in expressing recombinant Loligo bleekeri ND3 and how can they be addressed?

Expression of recombinant Loligo bleekeri ND3 presents several challenges due to its hydrophobic nature and mitochondrial origin. Common difficulties and solutions include:

Additionally, considering expression in eukaryotic systems like yeast or insect cells may provide better folding environments for this mitochondrial protein.

What quality control methods should be employed to verify the integrity of purified recombinant ND3?

Multiple quality control methods should be implemented to verify the integrity of purified recombinant Loligo bleekeri ND3:

• Purity Assessment:

  • SDS-PAGE with Coomassie staining (expect a band at ~13 kDa)

  • Western blot using anti-tag or specific antibodies

  • Size exclusion chromatography to assess homogeneity

• Structural Integrity:

  • Circular dichroism to confirm secondary structure components

  • Fluorescence spectroscopy to assess tertiary structure

  • Limited proteolysis to verify proper folding

• Functional Verification:

  • NADH oxidation activity assays

  • Ubiquinone binding assays

  • Inhibitor sensitivity profiles

• Storage Stability:

  • Monitor activity retention over time under different storage conditions

  • Assess freeze-thaw stability

  • Test different buffer formulations for optimal stability

Implementing these quality control measures ensures that experimental results obtained with the recombinant protein accurately reflect the native protein's properties.

What are the key knowledge gaps in Loligo bleekeri ND3 research that should be prioritized?

Despite available information on Loligo bleekeri ND3, several critical knowledge gaps remain that warrant focused research attention:

• High-resolution structural determination of Loligo bleekeri ND3 within the context of the complete Complex I

• Detailed characterization of the ubiquinone binding site and electron transfer pathway

• Comparative analysis of ND3 function across different cephalopod species adapted to various environments

• Investigation of post-translational modifications that may regulate ND3 activity

• Exploration of potential roles beyond respiratory chain function, including possible involvement in reactive oxygen species production or signaling

Addressing these knowledge gaps would significantly advance our understanding of mitochondrial function in marine invertebrates and potentially reveal unique adaptations in cephalopod energy metabolism.

How might research on Loligo bleekeri ND3 contribute to broader understanding of mitochondrial evolution?

Research on Loligo bleekeri ND3 has significant potential to contribute to our broader understanding of mitochondrial evolution in several ways:

• Cephalopods occupy a unique evolutionary position, and their mitochondrial proteins may reveal adaptations to marine environments and high metabolic demands.

• Comparing ND3 sequences and functions across diverse lineages can illuminate evolutionary constraints on respiratory chain components.

• Analysis of selection pressures on different regions of the protein, similar to methods used in the Triplophysa study (calculating dN/dS ratios), can identify functionally critical domains versus those allowing evolutionary flexibility .

• Investigation of species-specific variations may reveal molecular adaptations underlying the remarkable physiological capabilities of cephalopods, including their high energy metabolism supporting complex nervous systems and jet propulsion.