Recombinant Loligo forbesi Cytochrome c oxidase subunit 1 (COI)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Loligo forbesi Cytochrome c Oxidase Subunit 1 (COI)

Recombinant Loligo forbesi cytochrome c oxidase subunit 1 (COI) is a mitochondrial enzyme produced via heterologous expression in Escherichia coli. This protein is a critical component of Complex IV in the electron transport chain, facilitating the transfer of electrons from cytochrome c to molecular oxygen while contributing to proton gradient formation . Derived from the Northern European squid (Loligo forbesi), recombinant COI retains structural and functional properties of the native enzyme, making it valuable for biochemical, evolutionary, and biomedical research .

Protein Characteristics

PropertyDetails
SpeciesLoligo forbesi (Northern European squid)
UniProt IDQ9TGE6
Expression SystemE. coli (full-length protein, 1–213 amino acids)
TagN-terminal His-tag
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
ReconstitutionSterile water (0.1–1.0 mg/mL), optional 50% glycerol for long-term storage at -20°C/-80°C

The amino acid sequence includes conserved domains critical for heme-copper oxidase activity, such as transmembrane helices and metal-binding residues .

Phylogenetic and Population Genetics

COI serves as a mitochondrial DNA barcode for species identification and evolutionary studies. In Loligo forbesi, recombinant COI has been used to:

  • Resolve phylogeographic patterns across European and Mediterranean populations .

  • Identify genetic clades influenced by historical biogeographic barriers (e.g., Azores isolation) .

  • Analyze gene flow dynamics using microsatellite and COI haplotype data .

Protein Interaction Studies

  • Amyloid-β (Aβ) Binding: Recombinant COI interacts with Aβ 1–42, implicated in Alzheimer’s disease pathology. Molecular dynamics simulations show helix-helix interactions between COI and Aβ, suggesting mitochondrial dysfunction mechanisms .

  • Enzyme Kinetics: COI’s role in electron transport is studied using recombinant protein to quantify proton-pumping efficiency and oxygen reduction kinetics .

Comparative Analysis with Other COI Proteins

FeatureLoligo forbesi COIMammalian COI
Length213 amino acids 515–580 amino acids
Key DomainsTransmembrane helices 1–6 Additional regulatory domains
Metal Ligands2 Fe, 3 Cu, 1 Zn, 1 Mg Similar composition
Barcode UtilityHigh interspecies variability Limited due to conserved regions

Future Research Directions

  • Investigating COI’s role in mitochondrial Aβ toxicity in neurodegenerative models .

  • Developing COI inhibitors for metabolic disorder therapeutics .

  • Expanding metazoan barcode databases using recombinant COI standards .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipment, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50% and can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development according to your specifications.
Synonyms
COI; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-213
Protein Length
full length protein
Species
Loligo forbesi (Northern European squid)
Target Names
COI
Target Protein Sequence
IFGIWAGLVGTSLSLMIRTELGKPGSLLNDDQLYNVVVTAHGFIMIFFMVMPIMIGGFGN WLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSAVESGAGTGWTVYPPLSSNLSHAG PSVDLAIFSLHLAGISSILGAINFITTIMNMRWEGLLMERMSLFVWSVFITAILLLLSLP VLAGAITMLLTDRNFNTTFFDPSGGGDPILYQH
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 1 (COI) is a crucial component of cytochrome c oxidase, the terminal enzyme in the mitochondrial electron transport chain responsible for driving oxidative phosphorylation. The respiratory chain comprises three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work in concert to transfer electrons derived from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and the activity of ATP synthase. Cytochrome c oxidase plays a pivotal role in the respiratory chain by catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site located in subunit 1. This active site, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)), ultimately reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Loligo forbesi and what is the significance of its COI protein in research?

Loligo forbesi, commonly known as the veined squid or long-finned squid, is a commercially important species of squid in the family Loliginidae. This cephalopod grows up to 90 centimeters in mantle length and is characterized by diamond-shaped fins that make up approximately two-thirds of its body length . The species is widespread in European waters, ranging from the Atlantic Ocean to the Red Sea and East African coast .

The COI protein from L. forbesi is significant in research because:

  • It serves as a reliable molecular marker for species identification and authentication

  • It provides insights into population genetics and stock structure of this commercially important species

  • It enables evolutionary studies on cephalopod phylogeny and divergence patterns

  • It contributes to our understanding of mitochondrial gene function in cephalopods

How is recombinant Loligo forbesi COI typically produced for research applications?

Recombinant L. forbesi COI is typically produced using prokaryotic expression systems, predominantly E. coli. The production process involves:

  • Gene cloning: The COI gene from L. forbesi is amplified using PCR techniques with specifically designed primers that target conserved regions of the mitochondrial genome.

  • Vector construction: The amplified gene is ligated into an appropriate expression vector, often incorporating affinity tags (such as His-tags) to facilitate purification.

  • Transformation and expression: The recombinant vector is transformed into competent E. coli cells, followed by induction of protein expression under optimized conditions.

  • Protein purification: Expressed protein is typically purified using affinity chromatography techniques based on the incorporated tag (e.g., His-tag purification using nickel columns).

  • Quality control: The purified protein undergoes validation through techniques such as SDS-PAGE and mass spectrometry to confirm identity and purity.

Commercial recombinant L. forbesi COI products, such as those documented in the search results, typically achieve >95% purity and include a His-tag for purification purposes .

How can recombinant Loligo forbesi COI be used in population genetics and stock structure studies?

Recombinant L. forbesi COI and its corresponding gene sequences serve as valuable tools in population genetics studies, particularly for understanding stock structure in commercially exploited squid populations. Research methodologies include:

  • Genetic marker development: Recombinant COI can be used to develop species-specific primers for population studies.

  • Reference standard generation: Purified recombinant protein serves as a positive control in molecular assays targeting wild populations.

  • Comparative sequence analysis: COI sequences from different geographic locations can be analyzed to detect population structure.

Recent research by Sheerin et al. (2022) employed a multi-method approach to investigate L. forbesi stock structure across European waters. Although no statistically significant genetic sub-structure was found using mitochondrial and microsatellite markers, the study revealed subtle population differentiation patterns that could be important for fisheries management .

What methodologies are recommended for analyzing genetic variability in Loligo forbesi COI sequences?

Several methodological approaches can be employed to analyze genetic variability in L. forbesi COI sequences:

  • DNA extraction and amplification:

    • Standard DNA extraction from tissue samples (mantle, arm, or fin tissue)

    • PCR amplification using universal or species-specific COI primers

    • Recommended primer sets from literature include those targeting conserved regions flanking the variable domains of COI

  • Sequencing techniques:

    • Sanger sequencing for individual sample analysis

    • Next-generation sequencing for high-throughput population screening

    • Targeted amplicon sequencing for specific COI regions

  • Population genetic analyses:

    • Haplotype network construction

    • FST calculations for population differentiation

    • AMOVA (Analysis of Molecular Variance) to partition genetic variation

    • Bayesian clustering methods

  • Bioinformatic workflows:

    • Sequence alignment (MUSCLE, CLUSTAL)

    • Phylogenetic tree construction (Maximum Likelihood, Bayesian Inference)

    • Population structure analysis (STRUCTURE, GENELAND)

Research by Healey has demonstrated the utility of microsatellite DNA markers combined with COI analysis for detecting subtle population structuring within this highly vagile marine invertebrate .

What are the key differences between the COI sequence of Loligo forbesi and other cephalopod species?

Comparative analysis of COI sequences reveals both conservation and divergence patterns across cephalopod lineages:

SpeciesCOI Length (aa)Sequence Identity to L. forbesi (%)Notable Sequence Features
Loligo forbesi213100%Reference sequence with characteristic loliginid motifs
Doryteuthis pealeii223~92%Extended N-terminal region
Octopus vulgaris209~85%Shortened sequence with octopod-specific substitutions
Sepia officinalis223~83%Sepiid-specific amino acid variants

Key differences include:

  • Taxonomically informative amino acid substitutions in transmembrane domains

  • Variable loop regions that differ between major cephalopod lineages

  • Conserved catalytic sites across all cephalopod groups

  • Lineage-specific insertions/deletions, particularly at the N- and C-termini

These sequence differences are valuable for molecular systematics and can be exploited for species identification in mixed-species samples or processed seafood products.

What are the latest research findings regarding Loligo forbesi stock structure using molecular markers?

Recent research has provided significant insights into L. forbesi population structure:

  • Genetic homogeneity with subtle differentiation:

    • Sheerin et al. (2022) applied mitochondrial and microsatellite markers (nine loci) to samples from multiple locations including Rockall Bank, Scotland, North Sea, Ireland, English Channel, Bay of Biscay, northern Spain, and Bay of Cadiz.

    • No statistically significant genetic sub-structure was found, although some non-significant differentiation patterns were observed .

  • Migration and connectivity patterns:

    • Current evidence suggests that L. forbesi migrates inshore for breeding and offshore for feeding.

    • Long-range movements are implied by genetic homogeneity in the neritic population .

    • Only offshore populations (Faroe and Rockall Bank) were previously considered distinct.

  • Methodological advances:

    • Multi-method approaches combining different genetic markers provide more comprehensive insights than single-marker studies.

    • Integration of genetic data with morphological and ecological information yields a more complete understanding of population structure.

These findings have important implications for the management of L. forbesi fisheries, suggesting that the species may be managed as a largely single stock across much of its European range, with possible separate management for offshore populations.

What are the optimal conditions for storage and handling of recombinant Loligo forbesi COI?

For optimal stability and activity of recombinant L. forbesi COI, the following storage and handling conditions are recommended:

Storage recommendations:

  • Long-term storage: -20°C or -80°C for extended preservation

  • Working solutions: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles; store working aliquots separately

Buffer composition:
Based on similar recombinant proteins, optimal buffer conditions typically include:

  • Tris-based buffer (pH 7.5-8.0)

  • 50% glycerol for stability

  • Protein-specific additives for functional preservation

Handling precautions:

  • Maintain cold chain during all handling steps

  • Use sterile techniques to prevent contamination

  • Avoid exposure to strong oxidizing agents that may affect heme groups

  • Minimize exposure to extreme pH conditions

What experimental validation techniques are recommended for confirming the authenticity and activity of recombinant Loligo forbesi COI?

Several complementary techniques are recommended for validating recombinant L. forbesi COI:

  • Structural validation:

    • SDS-PAGE for molecular weight confirmation

    • Western blotting using anti-COI or anti-tag antibodies

    • Mass spectrometry for accurate mass determination and peptide mapping

    • Circular dichroism spectroscopy for secondary structure analysis

  • Functional validation:

    • Spectrophotometric assays to measure electron transfer activity

    • Oxygen consumption assays in reconstituted systems

    • Heme content quantification

    • Substrate binding assays

  • Purity assessment:

    • Analytical HPLC

    • SDS-PAGE with densitometry (aim for >95% purity)

    • Endotoxin testing for samples intended for cellular applications

  • Sequence confirmation:

    • N-terminal sequencing

    • Mass spectrometry-based peptide mapping

    • Comparison with reference sequences in databases

How can recombinant Loligo forbesi COI be effectively utilized in molecular phylogenetic studies?

Recombinant L. forbesi COI can enhance molecular phylogenetic studies through several methodological approaches:

  • Sequence-based phylogenetics:

    • Generate high-quality reference sequences from validated recombinant protein

    • Use for calibrating molecular clocks in evolutionary studies

    • Serve as outgroup or reference point in cephalopod phylogenies

  • Antibody generation and immunological studies:

    • Develop specific antibodies against L. forbesi COI

    • Use in comparative immunological studies across cephalopod species

    • Apply in tissue localization studies to understand expression patterns

  • Evolutionary rate analysis:

    • Compare substitution rates between L. forbesi and other species

    • Identify sites under selection pressure

    • Correlate molecular evolution with ecological adaptations

  • Methodological workflow:

    • Extract genomic DNA from tissue samples

    • Amplify COI region using universal or specific primers

    • Sequence amplicons and align with recombinant protein sequence

    • Construct phylogenetic trees using appropriate evolutionary models

    • Validate tree topology through bootstrap or posterior probability analysis

The extensive sequence data available for cephalopod COI genes makes this an excellent marker for investigating evolutionary relationships within Loliginidae and between cephalopod groups.

Comparative analysis of Loligo forbesi COI with other cephalopod species

SpeciesCommon NameCOI LengthGenBank Accession% Identity to L. forbesi
Loligo forbesiVeined squid213 aaQ9TGE6100%
Doryteuthis pealeiiLongfin inshore squid223 aaReferenced in ~92%
Octopus vulgarisCommon octopus209 aaReferenced in ~85%
Sepia officinalisCommon cuttlefish223 aaReferenced in ~83%
Sepia pharaonisPharaoh cuttlefish219 aaReferenced in ~82%

Commercial availability of recombinant Loligo forbesi COI and related proteins

ProductHost SystemTag TypeProtein LengthReference
Recombinant Full Length Loligo Forbesi COIE. coliHis-TaggedFull Length (1-213)
Recombinant Human Cytochrome CE. coliHis-TaggedFull Length (2-105)
Cytochrome C Oxidase Subunit Va, HumanE. coliHis-TaggedFull sequence provided

Biological characteristics of Loligo forbesi relevant to COI research

CharacteristicDetailsResearch ImplicationReference
HabitatDepths of 10-500 metersAdaptation to varying oxygen levels may affect COI function
Lifespan1-2 years (max 3 years)Short generation time affects genetic diversity patterns
BreedingSingle breeding cycle (semelparous)Population genetic structure influenced by breeding behavior
MigrationInshore for breeding, offshore for feedingGeographic genetic structure affected by migration patterns
DistributionEuropean waters, Atlantic Ocean, Red SeaWide distribution allows for comparative population genetics

Future research directions

Several promising research avenues deserve further investigation:

  • Integrated multi-marker approaches: Combining COI with other molecular markers and ecological data to provide a more comprehensive understanding of L. forbesi population dynamics.

  • Functional studies: Investigating the biochemical properties of recombinant L. forbesi COI to understand species-specific adaptations in the respiratory chain.

  • Metabarcoding applications: Developing environmental DNA (eDNA) approaches using COI markers for non-invasive monitoring of L. forbesi populations.

  • Structural biology: Determining the three-dimensional structure of L. forbesi COI to understand functional differences between cephalopod lineages.

  • Applied fisheries research: Utilizing COI markers in conjunction with tagging studies to better understand migration patterns and inform sustainable management practices.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.