Recombinant Loligo forbesi Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Description

Production and Expression

Recombinant L. forbesi rhodopsin is produced using an E. coli expression system, enabling high-yield purification .

ParameterDetails
Expression SystemE. coli (in vitro)
Expression RegionFull-length protein (residues 1–452)
TagN-terminal 10×His tag for affinity chromatography
Purity>90% (SDS-PAGE verified)
Storage-20°C (short-term); -80°C (long-term); avoid repeated freeze-thaw cycles

Mechanistic Studies

  • GPCR Signaling: Used to investigate light-activated phospholipase C pathways .

  • Retinal Binding: Serves as a model for studying retinal isomerization and Schiff base stability .

Disease Modeling

  • Retinal Dystrophies: Mislocalization mutants (e.g., Q344ter) are employed to study photoreceptor degeneration .

  • Pharmacological Chaperones: Screened alongside compounds like YC-001 to rescue misfolded rhodopsin mutants .

Comparative Analysis

FeatureL. forbesi RhodopsinBovine Rhodopsin
Amino Acid Length452348
C-terminal MotifQVAPAVAPA (truncated)
Expression SystemE. coliHEK293 cells
Chromophore Affinity11-cis-retinal11-cis-retinal

Key Research Findings

  • Structural Insights: Cryo-EM studies reveal conserved GPCR activation mechanisms shared with mammalian rhodopsin .

  • Mutagenesis: Cysteine residues (e.g., C110, C187) are critical for disulfide bond formation and structural integrity .

  • Pharmacology: Small molecules like YC-001 stabilize mutant rhodopsin, enhancing plasma membrane localization .

References

  1. Molecular cloning and primary structure of squid (Loligo forbesi) rhodopsin .

  2. UniProt entry P24603: Functional annotation and sequence data .

  3. Pharmacological chaperones for RHO-associated retinitis pigmentosa .

  4. Cusabio technical specifications for recombinant RHO .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request if possible.
Lead Time
Delivery time may vary based on your purchase method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your reconstitution process.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
RHO; Rhodopsin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
full length protein
Species
Loligo forbesi (Northern European squid)
Target Names
RHO
Target Protein Sequence
MGRDIPDNETWWYNPYMDIHPHWKQFDQVPAAVYYSLGIFIAICGIIGCVGNGVVIYLFT KTKSLQTPANMFIINLAFSDFTFSLVNGFPLMTISCFMKYWVFGNAACKVYGLIGGIFGL MSIMTMTMISIDRYNVIGRPMSASKKMSHRKAFIMIIFVWIWSTIWAIGPIFGWGAYTLE GVLCNCSFDYITRDTTTRSNILCMYIFAFMCPIVVIFFCYFNIVMSVSNHEKEMAAMAKR LNAKELRKAQAGANAEMKLAKISIVIVTQFLLSWSPYAVVALLAQFGPIEWVTPYAAQLP VMFAKASAIHNPMIYSVSHPKFRERIASNFPWILTCCQYDEKEIEDDKDAEAEIPAGEQS GGETADAAQMKEMMAMMQKMQAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPP QGYPPPPQGPPPQGPPPQAAPPQGVDNQAYQA
Uniprot No.

Target Background

Function
Rhodopsin is a photoreceptor crucial for image-forming vision under low light conditions. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change, activating signaling through G-proteins. This signaling pathway mediates the activation of phospholipase C. Subsequent receptor phosphorylation leads to displacement of the bound G-protein alpha subunit by arrestin, ultimately terminating signaling.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Loligo forbesi rhodopsin and how does it compare to other invertebrate visual pigments?

The N-terminal region contains the seven transmembrane domains typical of the GPCR superfamily, while the C-terminal region appears to be a distinctive feature of cephalopod visual pigments. When comparing Loligo forbesi rhodopsin to other invertebrate visual pigments, researchers should note that:

  • The protein's structural features suggest evolutionary conservation of the transmembrane domains involved in G-protein interaction

  • The sequence reveals specific residues that likely play crucial roles in chromophore binding and G-protein activation

  • Comparative analysis with other members of the GPCR superfamily highlights conserved motifs that maintain structural integrity and functional significance

How do researchers determine the retinal binding site in Loligo forbesi rhodopsin?

The retinal binding site in Loligo forbesi rhodopsin can be identified through a combination of approaches:

  • Protein and cDNA sequencing: Determining the primary structure reveals amino acid residues potentially involved in chromophore binding .

  • Comparative analysis: Alignment with other visual pigments such as bovine and octopus rhodopsins helps identify conserved lysine residues typically involved in forming the Schiff base with retinal .

  • Site-directed mutagenesis: Systematic modification of specific amino acids can confirm their importance in retinal binding.

  • Spectroscopic analysis: Changes in absorbance properties following specific amino acid substitutions can confirm the involvement of particular residues in the chromophore binding pocket.

Historical studies on squid visual pigments have identified key amino acid sequences involved in retinal binding, with techniques similar to those used by Seidou et al. in their analysis of retinal binding sites .

What expression systems are most effective for producing functional recombinant Loligo forbesi rhodopsin?

The choice of expression system is critical for obtaining functional recombinant Loligo forbesi rhodopsin. Based on research with related proteins:

E. coli-based systems: While E. coli has been successfully used for expressing recombinant rhodopsins (as demonstrated with mouse rhodopsin ), membrane proteins like rhodopsin often present challenges in bacterial systems due to:

  • Limited membrane insertion machinery

  • Absence of post-translational modifications

  • Potential formation of inclusion bodies

Insect cell expression: Baculovirus-infected insect cells (Sf9, High Five) often provide better folding environments for invertebrate membrane proteins and support critical post-translational modifications.

Mammalian cell lines: HEK293 or COS cells can be effective for rhodopsin expression when proper folding and glycosylation are essential.

For optimal expression, researchers should consider:

  • Using codon-optimization for the expression host

  • Including N-terminal signal sequences to enhance membrane targeting

  • Adding affinity tags (e.g., His-tag as used with mouse rhodopsin ) for purification while minimizing interference with protein folding

What purification strategies yield the highest functional activity for recombinant Loligo forbesi rhodopsin?

Purification of functional recombinant Loligo forbesi rhodopsin requires special consideration due to its membrane protein nature. Recommended approaches include:

  • Detergent selection: Fatty acid esters of sucrose have proven effective for cephalopod rhodopsins . Mild detergents like DDM (n-dodecyl β-D-maltoside) or CHAPS often preserve functional integrity.

  • Affinity chromatography: His-tagged constructs can be purified using nickel affinity chromatography, similar to the approach used for mouse rhodopsin .

  • Buffer composition:

    • pH range: 7.5-8.0 (similar to the condition used for mouse rhodopsin )

    • Adding glycerol (5-50%) to stabilize the protein structure

    • Including protease inhibitors to prevent degradation

  • Reconstitution protocol: Lyophilized protein should be reconstituted in deionized sterile water to concentrations of 0.1-1.0 mg/mL, with glycerol added for long-term storage .

StepConditionCritical Factors
Detergent ExtractionMild detergents (DDM, CHAPS)Detergent concentration, temperature
Affinity PurificationNi-NTA for His-tagged proteinImidazole gradient, flow rate
Buffer ExchangeTris/PBS-based buffer, pH 7.5-8.0Removal of imidazole
Storage-20°C/-80°C with 5-50% glycerolAliquoting to avoid freeze-thaw cycles

What spectroscopic methods are most appropriate for analyzing the chromophore environment in Loligo forbesi rhodopsin?

Spectroscopic analysis provides critical insights into the chromophore environment and photochemical properties of Loligo forbesi rhodopsin:

  • UV-Visible absorption spectroscopy: Determines the absorption maximum (λmax) and monitors spectral shifts during photoactivation. This technique can track conformational changes that occur during the rhodopsin photocycle.

  • Circular dichroism (CD) spectroscopy: Evaluates secondary structure elements and their changes upon light activation or during protein denaturation.

  • Fluorescence spectroscopy: Provides information about chromophore-protein interactions and conformational changes through:

    • Intrinsic tryptophan fluorescence

    • Energy transfer measurements between protein and chromophore

  • Resonance Raman spectroscopy: Offers detailed information about the chromophore configuration and its interactions with the protein binding pocket.

When interpreting spectroscopic data, researchers should consider findings from previous studies on cephalopod visual pigments, such as Koutalos et al.'s work on octopus photoreceptor membranes which examined Schiff base properties .

How can researchers assess G-protein interactions with Loligo forbesi rhodopsin?

G-protein interaction studies are essential for understanding rhodopsin function. For Loligo forbesi rhodopsin, several approaches can be employed:

  • GTPγS binding assays: Measures the ability of light-activated rhodopsin to catalyze nucleotide exchange on G-proteins.

  • Co-immunoprecipitation: Detects physical association between rhodopsin and G-protein subunits under different conditions (dark state, photo-activated).

  • FRET/BRET analysis: Evaluates real-time interactions between fluorescently labeled rhodopsin and G-proteins.

  • GTPase activity measurements: Quantifies the rate of GTP hydrolysis by G-proteins when activated by rhodopsin, similar to methods described by Saibil and Michel-Villaz who demonstrated that squid rhodopsin can crossreact with vertebrate photoreceptor enzymes .

For experimental design, researchers should note that:

  • Light-activated rhodopsin catalyzes the exchange of GTP for bound GDP in G-proteins

  • Squid rhodopsin and GTP-binding proteins can crossreact with vertebrate photoreceptor enzymes

  • The phosphatidylinositol-specific phospholipase C-directed GTP-binding protein from Loligo forbesi photoreceptors has been sequenced and characterized

How does Loligo forbesi rhodopsin serve as a model system for understanding GPCR structure-function relationships?

Loligo forbesi rhodopsin offers several advantages as a model system for GPCR research:

  • Evolutionary insights: Comparing invertebrate and vertebrate rhodopsins reveals conserved structural elements essential for GPCR function across species.

  • Specialized domains: The unique proline-rich C-terminal region (residues 340-452) may provide insights into specialized signaling mechanisms not present in other GPCRs .

  • Experimental advantages:

    • Stability in detergent solutions

    • Abundant natural source material

    • Amenable to recombinant expression and purification

  • Structure prediction: Comparison of Loligo forbesi rhodopsin with other members of the G-protein-linked receptor superfamily reveals features with both structural and functional importance , which can inform computational models of GPCR activation.

Studies have demonstrated that insights from invertebrate visual pigments can be applied to understand general principles of GPCR signaling, as shown by research examining the chromophore's role in deactivation of opsin and photoactivation of the pigment .

What crystallization strategies have proven successful for structural determination of rhodopsins and how might they apply to Loligo forbesi rhodopsin?

Crystallization of membrane proteins like rhodopsin presents significant challenges. Based on advances in rhodopsin structural biology:

  • Detergent selection: The choice of detergent is critical for maintaining protein stability while allowing crystal contacts. Fatty acid esters of sucrose have proven effective for cephalopod rhodopsins .

  • Lipidic cubic phase (LCP) crystallization: This method has revolutionized GPCR crystallography by providing a membrane-like environment:

    • Rhodopsin is incorporated into a monoolein-based cubic phase

    • Crystallization occurs within the lipidic matrix

    • This approach may be particularly suitable for Loligo forbesi rhodopsin

  • Protein engineering approaches:

    • T4 lysozyme or BRIL fusion proteins to increase polar surface area

    • Truncation of flexible regions (potentially the proline-rich C-terminus in Loligo forbesi rhodopsin)

    • Antibody fragment co-crystallization to stabilize specific conformations

  • Alternative methods: When crystallization proves challenging, researchers can consider:

    • Cryo-electron microscopy for structural determination

    • Nuclear magnetic resonance approaches for specific domains

Success in crystallizing Loligo forbesi rhodopsin would significantly advance our understanding of invertebrate visual pigments and provide comparative insights with vertebrate rhodopsins.

What approaches help overcome protein misfolding during recombinant expression of Loligo forbesi rhodopsin?

Membrane protein misfolding is a common challenge when expressing recombinant rhodopsins. For Loligo forbesi rhodopsin, researchers can implement:

  • Expression optimization:

    • Lower temperature induction (16-20°C) to slow protein synthesis and allow proper folding

    • Reduced inducer concentration to prevent overwhelming the cellular folding machinery

    • Co-expression with molecular chaperones to assist correct folding

  • Construct design improvements:

    • Fusion with well-folding partners (MBP, thioredoxin) at the N-terminus

    • Codon optimization for the expression host

    • Signal sequences to target the secretory pathway in eukaryotic systems

  • Post-expression approaches:

    • In vitro refolding protocols with decreasing detergent concentrations

    • Addition of lipids during purification to stabilize native conformation

    • Chromophore addition during purification to stabilize tertiary structure

When working with lyophilized recombinant rhodopsin, careful reconstitution is essential. For mouse rhodopsin, brief centrifugation prior to opening brings contents to the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

How can researchers distinguish between functional and non-functional forms of recombinant Loligo forbesi rhodopsin?

Differentiating functional from non-functional rhodopsin is crucial for experimental reliability. Recommended methods include:

  • Spectroscopic analysis:

    • Properly folded rhodopsin with incorporated chromophore shows characteristic absorption at ~490-500 nm

    • Light-dependent spectral shifts indicate functional photocycling

    • Difference spectroscopy (dark minus light) quantifies functional protein

  • Thermal stability assays:

    • Functional rhodopsin typically shows higher thermal stability than misfolded variants

    • Differential scanning fluorimetry can measure melting temperatures

  • G-protein activation assays:

    • Functional rhodopsin activates G-proteins in a light-dependent manner

    • GTPγS binding assays can quantify activation efficiency

  • Isoelectric focusing:

    • Different isoforms of rhodopsin (with/without chromophore) can be separated

The functional studies of interactions between apoprotein and chromophore have clarified the role of the chromophore in deactivation of opsin and photoactivation of the pigment , providing basis for distinguishing functional from non-functional forms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.