Recombinant Loligo subulata Rhodopsin (RHO)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
RHO; Rhodopsin; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-439
Protein Length
full length protein
Species
Alloteuthis subulata (Squid) (Loligo subulata)
Target Names
RHO
Target Protein Sequence
NETWWYNPYMDIHSHWKQFDQVPAAVYYSLGIFIAICGIIGCAGNGIVIYLFTKTKSLQT PANMFIINLAFSDFTFSLVNGFPMMTISCFLKHWVFGQAACKVYGLIGGIFGLTSIMTMT MISIDRYNVIRRPMSASKKMSHRKAFIMIVFVWIWSTIWAIGPIFGWGAYQLEGVLCNCS FDYITRDASTRSNIVCMYIFAFMFPIVVIFFCYFNIVMSVSNHEKEMAAMAKRLNAKELR KAQAGASAEMKLAKISIVIVTQSLLSWSPYAIVALLAQFGPIEWVTPYAAQLPVMFAKAS AIHNPMIYSVSHPKFREAIASNFPWILTCCQYDEKEIEDDKDAEAEIPAAEQSGGESVDA AQMKEMMAMMQKMQAQQQQQPAYPPQGYPPQGYPPPPPQGYPPQGYPPQGYPPQGYPPPP QGPPPQGPPPQAAPPQGVD
Uniprot No.

Target Background

Function
Photoreceptor essential for image-forming vision under low light conditions. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. This signaling mediates the activation of phospholipase C. Subsequent receptor phosphorylation leads to displacement of the bound G-protein alpha subunit by arrestin, terminating the signaling process.
Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What distinguishes Loligo subulata rhodopsin from mammalian rhodopsins?

Loligo subulata rhodopsin, like other cephalopod visual pigments, shares the fundamental structure of a G protein-coupled receptor with mammalian rhodopsins, but with several distinct characteristics. Unlike mammalian rhodopsins that are expressed exclusively in rod photoreceptor cells of the retina, squid rhodopsins exist in rhabdomeric photoreceptors with different signaling pathways .

The key structural differences include:

  • Different patterns of glycosylation compared to mammalian rhodopsin's Asn2 and Asn15 sites

  • Variations in the chromophore binding pocket that affect spectral tuning

  • Unique phosphorylation sites that differ from the Ser334, Ser338, and Ser343 seen in mammalian rhodopsins

  • Potentially different oligomerization patterns in native membranes

These differences make Loligo subulata rhodopsin valuable for comparative studies of GPCR evolution and function across species.

What is the molecular weight and basic structure of recombinant Loligo subulata rhodopsin?

Recombinant Loligo subulata rhodopsin is a seven-transmembrane domain G protein-coupled receptor with a molecular weight of approximately 35-40 kDa, depending on post-translational modifications. The protein consists of:

  • N-terminal extracellular domain with glycosylation sites

  • Seven α-helical transmembrane segments (TM1-TM7)

  • Three extracellular loops (ECL1-3)

  • Three intracellular loops (ICL1-3)

  • C-terminal cytoplasmic domain with potential phosphorylation sites

The protein covalently binds retinal as its chromophore through a Schiff base linkage to a conserved lysine residue in the seventh transmembrane helix, similar to the arrangement seen in other rhodopsins .

How does the spectral sensitivity of Loligo subulata rhodopsin compare to other species?

Loligo subulata rhodopsin has evolved spectral properties adapted to the marine environment. Its absorption maximum typically falls between 475-495 nm, optimized for the blue-green light that penetrates ocean waters. The spectral tuning arises from specific amino acid residues in the chromophore binding pocket that interact with the retinal chromophore.

SpeciesAbsorption Maximum (nm)Habitat
Loligo subulata475-495Marine (variable depths)
Bovine rhodopsin500Terrestrial
Human rhodopsin498Terrestrial
Deep-sea fish rhodopsin470-490Deep marine

These spectral differences reflect evolutionary adaptations to different light environments and can be studied through comparative analysis of the chromophore binding pocket residues.

What are the most effective expression systems for producing recombinant Loligo subulata rhodopsin?

Several heterologous expression systems have been developed for rhodopsin expression, each with specific advantages for Loligo subulata rhodopsin:

Mammalian cell systems (HEK293, COS-7):

  • Advantages: Proper post-translational modifications, particularly glycosylation; mammalian cellular machinery facilitates correct folding

  • Challenges: Lower yield compared to other systems; higher cost

Insect cell systems (Sf9, High Five):

  • Advantages: Higher expression levels than mammalian cells; suitable post-translational modifications

  • Challenges: Different glycosylation patterns; more complex culture requirements

Yeast systems (Pichia pastoris):

  • Advantages: High yield; ability to scale up; less expensive than mammalian/insect systems

  • Challenges: Differences in membrane composition; potential hyperglycosylation

Cell-free expression systems:

  • Advantages: Rapid production; ability to incorporate non-natural amino acids

  • Challenges: Limited post-translational modifications; lower yield of correctly folded protein

The choice depends on research goals. For structural studies requiring large amounts of protein, insect cells or yeast might be preferable, while for functional studies requiring native-like modifications, mammalian cells are often optimal .

What purification strategy yields the highest purity and functional integrity of recombinant Loligo subulata rhodopsin?

A multi-step purification strategy is typically required to obtain high-purity functional rhodopsin:

  • Solubilization: Gentle solubilization using mild detergents such as n-dodecyl β-D-maltoside (DDM) at concentrations of 0.5-1% is critical for maintaining rhodopsin's structure and function. More aggressive detergents like Triton X-100 may destabilize protein-protein interactions as observed in rhodopsin-guanylate cyclase studies .

  • Affinity chromatography: Using epitope tags (His, FLAG, 1D4) for selective capture. The 1D4 monoclonal antibody approach has been particularly successful for rhodopsin purification when the C-terminal 1D4 epitope is engineered into the construct .

  • Size exclusion chromatography: To separate monomeric rhodopsin from aggregates and oligomers.

  • Ion exchange chromatography: As a polishing step to remove remaining impurities.

Critical factors affecting purification quality:

  • Temperature (maintain 4°C throughout)

  • Light exposure (minimize using dim red light conditions)

  • Buffer composition (phosphate buffers with glycerol and specific detergent concentrations)

  • Presence of stabilizing agents (retinal, zinc ions)

When optimized, this approach typically yields protein with >95% purity and preserved spectral properties.

How can I assess the functional integrity of purified recombinant Loligo subulata rhodopsin?

Multiple complementary assays are essential to confirm functional integrity:

Spectroscopic characterization:

  • UV-visible absorption spectroscopy to verify characteristic absorption peak (475-495 nm)

  • Monitor spectral shift upon photoactivation (conversion of rhodopsin to metarhodopsin states)

  • Determine A280/Amax ratio (typically 1.6-2.0 for pure rhodopsin)

Biochemical assays:

  • Thermal stability measurements

  • Retinal binding capacity

  • G protein activation assays (using native squid G proteins or engineered systems)

Structural integrity tests:

  • Circular dichroism to assess secondary structure

  • Limited proteolysis patterns

  • Glycosylation and phosphorylation status verification by mass spectrometry

Reconstitution tests:

  • Functional incorporation into liposomes or nanodiscs

  • Light-dependent conformational changes measured by fluorescence or EPR spectroscopy

A functionally intact preparation should demonstrate proper spectral characteristics, G protein coupling capability, and stability in detergent solutions at 4°C for at least 24-48 hours .

How do I identify and characterize protein-protein interactions involving Loligo subulata rhodopsin?

Several complementary approaches can be used to identify and characterize rhodopsin-interacting proteins:

Co-immunoprecipitation (Co-IP):
The most direct approach involves:

  • Solubilizing membranes under mild conditions (0.5-1.0% n-dodecyl β-D-maltoside)

  • Immunoprecipitation using specific antibodies against rhodopsin or epitope tags

  • Analysis of co-precipitated proteins by immunoblotting or mass spectrometry

Critical considerations include:

  • Detergent type and concentration significantly affect co-IP efficiency of membrane protein complexes

  • Rhodopsin-protein interactions may be detergent-sensitive, as seen with guanylate cyclase-1 (GC-1) whose co-precipitation with rhodopsin diminishes at higher detergent concentrations

  • Use appropriate controls (non-immune IgG, epitope-blocking peptides) to confirm specificity

Crosslinking approaches:

  • Chemical crosslinkers with varying spacer lengths can capture transient interactions

  • Photo-crosslinking with unnatural amino acids incorporated at specific sites

  • Analysis of crosslinked products by mass spectrometry

Proximity labeling methods:

  • BioID or APEX2 fusion constructs for in vivo identification of proximal proteins

  • TurboID for rapid biotin labeling of interacting proteins

Functional reconstitution:

  • In vitro reconstitution of purified components to verify direct interactions

  • FRET/BRET assays for monitoring interactions in living cells

What techniques are most effective for structural characterization of Loligo subulata rhodopsin?

Multiple complementary techniques provide insights into different aspects of rhodopsin structure:

X-ray crystallography:

  • Provides high-resolution static structures

  • Requires formation of well-diffracting crystals, often facilitated by:

    • Lipidic cubic phase crystallization

    • Thermostabilizing mutations

    • Antibody fragment co-crystallization

    • Removal of flexible regions

Cryo-electron microscopy:

  • Increasingly powerful for membrane proteins without crystallization

  • Can capture multiple conformational states

  • May require incorporation into nanodiscs or amphipols

  • Resolution now routinely reaches 3-4Å for GPCRs

NMR spectroscopy:

  • Provides dynamic information about specific regions

  • Solid-state NMR particularly valuable for membrane proteins

  • Can detect microsecond-to-millisecond timescale fluctuations in helix dynamics during activation

Molecular modeling and simulation:

  • Homology modeling based on related rhodopsin structures

  • Molecular dynamics simulations to study conformational changes

  • QM/MM methods to investigate chromophore-protein interactions

A comprehensive structural understanding typically requires integration of multiple techniques, as each provides unique and complementary insights .

How can I study the oligomerization properties of Loligo subulata rhodopsin?

Rhodopsin, like other GPCRs, forms oligomers in native membranes with functional consequences . Several techniques are valuable for studying these properties:

Biochemical approaches:

  • Blue native PAGE to preserve native oligomeric states

  • Crosslinking with bifunctional reagents followed by SDS-PAGE

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

  • Analytical ultracentrifugation of detergent-solubilized preparations

Biophysical techniques:

  • FRET/BRET between differently labeled rhodopsin molecules

  • Fluorescence recovery after photobleaching (FRAP) to assess mobility

  • Single-molecule tracking to determine oligomerization dynamics

  • Atomic force microscopy of native or reconstituted membranes

Functional studies:

  • Coexpression of wildtype and mutant forms to assess functional complementation

  • Single-molecule electrophysiology

  • G protein activation assays with defined oligomeric states

The measured dissociation constant (Kd) between opsin molecules is approximately 10^-5 M , but this may vary for Loligo subulata rhodopsin and should be experimentally determined.

How does light activation affect the molecular structure and function of Loligo subulata rhodopsin?

Light activation of rhodopsin triggers a series of conformational changes:

  • Initial photoisomerization: Light absorption causes 11-cis-retinylidene chromophore to isomerize to all-trans-retinylidene

  • Sequential conformational intermediates: Formation of bathorhodopsin, lumirhodopsin, metarhodopsin I, and metarhodopsin II states

  • Transmembrane helix movements: Primary conformational changes occur at the cytoplasmic end of helix VI

  • Increased conformational flexibility: NMR studies have shown helix fluctuations on a microsecond-to-millisecond timescale during the Meta I-Meta II equilibrium

  • Exposure of G protein binding sites: These structural changes enable productive binding to G proteins

In Loligo subulata rhodopsin, these changes may have unique characteristics compared to mammalian rhodopsins, particularly in:

  • The rate of photoactivation steps

  • The stability of intermediates

  • The specific conformational changes in transmembrane domains

  • The G protein coupling preferences

These differences would reflect adaptations to the squid's marine visual environment and signaling requirements.

What methods are most reliable for measuring G protein activation by recombinant Loligo subulata rhodopsin?

Several established assays measure G protein activation by rhodopsin:

GTPγS binding assay:

  • Measures binding of non-hydrolyzable GTP analog to G protein α subunit

  • Can be performed with radiolabeled [³⁵S]GTPγS or fluorescent BODIPY-GTPγS

  • Provides quantitative measure of activation rate and extent

  • Requires purified G proteins (native squid G proteins or mammalian homologs)

GTP hydrolysis assays:

  • Measures release of inorganic phosphate from GTP

  • Can use colorimetric methods (malachite green) or radioactive [γ-³²P]GTP

  • Provides information on both GDP/GTP exchange and GTPase activity

FRET-based methods:

  • Conformational FRET sensors within G protein subunits

  • Measures real-time activation kinetics

  • Can be performed in reconstituted systems or cells

  • Provides detailed kinetic parameters

Bioluminescence resonance energy transfer (BRET):

  • Uses luciferase-tagged rhodopsin and fluorescent-tagged G proteins

  • Allows monitoring of interactions in living cells

  • Provides information about association/dissociation kinetics

For Loligo subulata rhodopsin, assay optimization should account for:

  • Optimal pH and ionic conditions for squid rhodopsin function

  • Temperature sensitivity of interactions

  • Appropriate G protein subtypes (Gq/11 for rhabdomeric photoreceptors)

How can I study the desensitization and recycling mechanisms of Loligo subulata rhodopsin?

GPCR desensitization typically involves phosphorylation and arrestin binding. For studying these processes in Loligo subulata rhodopsin:

Phosphorylation analysis:

  • In vitro phosphorylation assays using purified rhodopsin kinases

  • Mass spectrometry to identify specific phosphorylation sites

  • Phospho-specific antibodies to track phosphorylation status

  • Site-directed mutagenesis of potential phosphorylation sites

Mammalian rhodopsin is phosphorylated at Ser334, Ser338, and Ser343 in the C-terminal region , but squid rhodopsin may have different phosphorylation patterns that should be determined experimentally.

Arrestin binding:

  • Co-precipitation of arrestin with activated and phosphorylated rhodopsin

  • FRET/BRET between labeled arrestin and rhodopsin

  • Surface plasmon resonance for binding kinetics

  • Cell-based translocation assays

Recycling and regeneration:

  • Tracking chromophore exchange rates

  • Measuring dephosphorylation kinetics

  • Membrane trafficking studies in cell culture models

  • Pulse-chase experiments to monitor protein turnover

Understanding these mechanisms is crucial for designing experiments involving repeated light stimulation and for developing strategies to maintain functional rhodopsin in experimental systems.

How can deep mutational scanning be applied to study Loligo subulata rhodopsin structure-function relationships?

Deep mutational scanning (DMS) is a powerful approach for comprehensive analysis of sequence-function relationships:

Methodology:

  • Create a comprehensive library of single amino acid variants

  • Express the variant library in an appropriate system

  • Subject the library to selection based on:

    • Plasma membrane expression levels

    • Proper folding

    • Ligand binding capability

    • G protein activation

  • Use next-generation sequencing to quantify variant frequencies before and after selection

  • Calculate enrichment/depletion scores for each variant

This approach has been successfully applied to study plasma membrane expression of pathogenic rhodopsin variants and can be adapted for Loligo subulata rhodopsin to:

  • Identify critical residues for proper folding and trafficking

  • Map the binding interface with G proteins and other interaction partners

  • Determine regions important for spectral tuning

  • Understand species-specific functional adaptations

Key considerations include:

  • Selection of appropriate expression system (mammalian cells preferable)

  • Development of reliable selection strategies

  • Computational analysis pipeline for processing sequencing data

  • Validation of key findings with individual variant characterization

What strategies can improve the stability and expression of recombinant Loligo subulata rhodopsin for structural studies?

Several approaches can enhance stability and expression:

Protein engineering strategies:

  • Targeted mutations based on evolutionary analysis

  • Alanine scanning of flexible regions

  • Introduction of disulfide bonds to stabilize specific conformations

  • Replacement of exposed hydrophobic residues

  • Creation of fusion constructs with well-expressing partners

  • Truncation of flexible N- and C-termini

Expression optimizations:

  • Codon optimization for expression host

  • Addition of molecular chaperones as co-expression partners

  • Temperature optimization (typically lower temperatures improve folding)

  • Induction protocol optimization

  • Addition of chemical chaperones to culture medium

Post-extraction stabilization:

  • Screening of detergent/lipid mixtures

  • Addition of specific lipids (cholesterol, phospholipids)

  • Inclusion of retinal analogs with improved stability

  • Nanobody or antibody fragment co-purification

  • Reconstitution into nanodiscs or lipidic cubic phase

These approaches have significantly advanced structural studies of mammalian rhodopsins and can be adapted for Loligo subulata rhodopsin .

How can I use recombinant Loligo subulata rhodopsin to study evolutionary adaptations in visual systems?

Comparative studies between different rhodopsins provide insights into evolutionary adaptations:

Spectral tuning analysis:

  • Site-directed mutagenesis of key residues in the chromophore binding pocket

  • Hybrid rhodopsins combining domains from different species

  • Absorption spectroscopy of variant rhodopsins

  • Quantum mechanical/molecular mechanical (QM/MM) simulations

G protein coupling specificity:

  • Comparison of coupling efficiency to different G protein subtypes

  • Chimeric G proteins to map interaction interfaces

  • In vitro and cell-based signaling assays

  • Cross-species complementation experiments

Adaptation to environmental factors:

  • Temperature sensitivity compared to rhodopsins from different thermal niches

  • Pressure effects on activation (relevant for marine species)

  • pH sensitivity and ionic requirements

  • Light intensity response ranges

Comparative expression and stability:

  • Folding efficiency in heterologous systems

  • Membrane integration properties

  • Resistance to thermal and chemical denaturation

  • Chromophore binding kinetics and stability

These studies help understand how visual pigments have adapted to diverse ecological niches and provide insights into the molecular basis of vision across species .

What are the most common challenges in expressing functional Loligo subulata rhodopsin and how can they be addressed?

Several challenges commonly arise when working with recombinant rhodopsin:

Low expression levels:

  • Optimize codon usage for expression host

  • Test different promoters and expression vectors

  • Evaluate different cell lines or expression systems

  • Consider fusion tags that enhance expression (e.g., GPCR fusion partners)

  • Lower expression temperature (28-30°C for mammalian cells)

  • Add chemical chaperones (e.g., 4-phenylbutyrate, DMSO at 1-2%)

Misfolding and aggregation:

  • Ensure sufficient 11-cis retinal is available during expression

  • Add chemical chaperones to culture medium

  • Co-express molecular chaperones

  • Optimize cell density and induction protocols

  • Use directed evolution to identify better-folding variants

Poor membrane localization:

  • Verify glycosylation status, as proper glycosylation is crucial for rhodopsin trafficking

  • Assess potential interaction with transport machinery

  • Co-express trafficking partners like GC-1 that may facilitate proper localization

  • Optimize signal peptide sequence

Instability after purification:

  • Screen different detergents and lipid additives

  • Maintain strict temperature control (4°C)

  • Include stabilizing agents (glycerol, specific ions)

  • Consider approaches like conformational stabilization with nanobodies

For Loligo subulata rhodopsin specifically, adaptations to a marine environment may require adjustments to buffer conditions, such as higher ionic strength or specific ion requirements.

How can I troubleshoot and optimize co-precipitation experiments to study Loligo subulata rhodopsin interactions?

Co-immunoprecipitation (co-IP) is valuable for studying rhodopsin interactions but requires careful optimization:

Detergent considerations:

  • Detergent type dramatically affects protein complex stability

  • Start with mild detergents like n-dodecyl β-D-maltoside at minimal concentrations (0.5-1%)

  • The efficiency of GC-1 co-precipitation with rhodopsin diminishes with increased detergent concentration

  • Avoid harsh detergents like Triton X-100 that disrupt rhodopsin-protein interactions

Sample preparation:

  • Use gentle homogenization without vortexing or sonication

  • Clear lysates at high speed (100,000g for 20 min at 4°C)

  • Include appropriate protease and phosphatase inhibitors

  • Perform all steps at 4°C under dim red light

Antibody selection and controls:

  • Use monoclonal antibodies with high specificity (like 1D4 for rhodopsin)

  • Include non-immune IgG controls

  • Perform epitope blocking controls with competing peptides

  • Optimize antibody concentration and incubation conditions

Detection challenges:

  • When detecting rhodopsin in GC-1 precipitates, address the molar excess issue (rhodopsin is expressed at >1000-fold excess over GC-1)

  • Use minimal amounts of beads fully saturated with antibody

  • Consider using heterozygous models expressing less rhodopsin to improve signal-to-noise ratio

  • Employ sensitive detection methods for low-abundance proteins

Following these guidelines, specific protein-protein interactions can be reliably detected despite the technical challenges of membrane protein biochemistry.

What quality control methods ensure the reliability of functional assays with recombinant Loligo subulata rhodopsin?

Rigorous quality control is essential for reliable functional studies:

Protein integrity verification:

  • SDS-PAGE for purity assessment (>95% purity recommended)

  • Western blotting to confirm full-length protein

  • Mass spectrometry to verify:

    • Correct primary sequence

    • Appropriate post-translational modifications

    • Absence of proteolytic degradation

Spectroscopic characterization:

  • Verify characteristic absorption spectrum (475-495 nm range)

  • Calculate A280/Amax ratio (typical range 1.6-2.0 for pure rhodopsin)

  • Confirm complete bleaching upon light exposure

  • Measure thermal stability by tracking spectral changes at elevated temperatures

Functional verification:

  • Light-dependent conformational change (measured by intrinsic fluorescence or EPR)

  • G protein activation capability (using GTPγS binding or similar assays)

  • Proper reconstitution into lipid bilayers or nanodiscs

Experimental controls:

  • Include inactive rhodopsin controls (opsin without chromophore)

  • Use constitutively active mutants as positive controls

  • Perform parallel experiments with well-characterized rhodopsin (e.g., bovine) as reference

  • Include light and dark controls in all experiments

Batch consistency:

  • Establish acceptance criteria for each batch

  • Maintain detailed records of expression conditions

  • Create standard preparations for assay calibration

  • Consider single-use aliquots to avoid freeze-thaw cycles

Implementing these quality control measures ensures that experimental observations truly reflect the properties of properly folded, functional Loligo subulata rhodopsin.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.