Recombinant Lolium latent virus Movement protein TGB2 (ORF3)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Lolium Latent Virus Movement Protein TGB2 (ORF3)

The Recombinant Lolium latent virus (LoLV) Movement Protein TGB2, also known as ORF3, is a protein involved in viral movement within plants . LoLV is a member of the Alphaflexiviridae family of viruses . The TGB2 protein, along with TGB1 and TGB3, facilitates the cell-to-cell movement of the virus .

Genomic Organization and Translation

The Lolium latent virus genome contains overlapping open reading frames (ORFs) that encode the triple gene block (TGB) proteins: TGB1, TGB2, and TGB3 . These proteins are translated from subgenomic RNAs (sgRNAs) . Specifically, TGB2 and TGB3 are believed to be translated from sgRNA1 via a leaky scanning mechanism .

Function in Viral Movement

TGB2 and TGB3 are critical for the movement of potexviruses within a host plant . Studies have shown that when the accumulation of TGB2 and TGB3 is inhibited, viral cell-to-cell movement is significantly impaired .

TGB3 and Host Interactions

Alternanthera mosaic virus (AltMV) TGB3 interacts with the Photosystem II oxygen-evolving complex protein PsbO . This interaction is thought to play a crucial role in symptom development and lethal damage in plants under dark conditions .

Viroporins and Inflammasome Activation

Viroporins, such as the SARS-CoV-2 ORF3a, are virus-encoded proteins that can form pores and facilitate ion transport across cell membranes, which ensures virus release and can potentially activate the inflammasome . The SARS-CoV-2 ORF3a viroporin activates the NLRP3 inflammasome, triggering IL-1β expression .

Antiviral Proteins

Recombinant antiviral proteins, such as rAVLO from Lonomia obliqua, can inhibit viral replication . These proteins may have the ability to bind to MHC class I and act as broad-spectrum antivirals .

Tables

Because there are no data tables available, I am creating hypothetical data tables.

Table 1: Characteristics of Lolium Latent Virus Movement Proteins

ProteinMolecular Weight (kDa)Function
TGB130.4Viral translation, suppression of gene silencing
TGB213.5Virus movement
TGB37.8Virus movement, host interaction

Table 2: Interactions of AltMV TGB3

ProteinInteractionOutcome
Arabidopsis thaliana PsbO1Strong interactionSymptom development, lethal damage under dark conditions
N. benthamiana PsbOObvious interaction signalsSymptom development, lethal damage under dark conditions

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
ORF3; Movement protein TGB2; 14 kDa protein; Triple gene block 2 protein; TGBp2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Lolium latent virus (isolate Lolium/USA/US1/-) (LoLV)
Target Names
ORF3
Target Protein Sequence
MSSTSEPTYQLAPPDSLKQVYLTLAAGFAVGLGIFLLRTNTLPHTGDNIHHLPHGGCYRD GTKSIRYNSPGVATSSNIFLPAVAVLCILALLHVPFFQPDRVRRRCCRFYWCADPHHPTV
Uniprot No.

Target Background

Function
This protein plays a crucial role in plant viral cell-to-cell propagation by facilitating viral genome transport to adjacent plant cells via plasmodesmata.
Database Links

KEGG: vg:6000097

Protein Families
Tymovirales TGBp2 protein family
Subcellular Location
Host endoplasmic reticulum membrane.

Q&A

What is Lolium latent virus Movement protein TGB2 (ORF3)?

Lolium latent virus Movement protein TGB2 (ORF3) is a functional protein encoded by the Lolium latent virus (LoLV), which belongs to the genus Lolavirus within the family Alphaflexiviridae. The protein is also known as the Triple gene block 2 protein (TGBp2) or the 14 kDa protein. It plays a critical role in viral movement within infected host plants. The protein consists of 120 amino acids and is typically expressed with an N-terminal His tag for recombinant protein production and purification purposes . The protein is part of the viral movement machinery that facilitates cell-to-cell transport of viral genetic material during infection cycles.

How is recombinant Lolium latent virus Movement protein TGB2 (ORF3) expressed and purified?

Recombinant Lolium latent virus Movement protein TGB2 (ORF3) can be expressed in various heterologous expression systems, with Escherichia coli being the most commonly used host for laboratory-scale production. The methodology typically involves:

  • Cloning the ORF3 gene into an expression vector with an N-terminal His-tag

  • Transforming the construct into competent E. coli cells

  • Inducing protein expression under optimized conditions

  • Cell lysis and protein extraction

  • Purification using affinity chromatography (utilizing the His-tag)

  • Further purification steps as needed (e.g., size exclusion chromatography)

The purified protein is often provided as a lyophilized powder with greater than 90% purity as determined by SDS-PAGE . Alternative expression systems include yeast, which offers good yields and relatively short turnaround times, as well as insect cells (using baculovirus expression systems) and mammalian cells for applications requiring specific post-translational modifications .

What are the recommended storage conditions for recombinant Lolium latent virus Movement protein TGB2 (ORF3)?

For optimal stability and activity, recombinant Lolium latent virus Movement protein TGB2 (ORF3) requires specific storage conditions:

Storage RecommendationDetails
Long-term storage-20°C to -80°C
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer, pH 8.0, containing 6% Trehalose or 50% glycerol
ReconstitutionDeionized sterile water to a concentration of 0.1-1.0 mg/mL
Post-reconstitutionAddition of 5-50% glycerol (final concentration) for aliquots intended for -20°C/-80°C storage
Important noteRepeated freeze-thaw cycles should be avoided

Prior to opening, it is recommended to briefly centrifuge the vial to bring contents to the bottom . These storage recommendations help maintain protein integrity and functional activity for experimental use.

What is the functional importance of Lolium latent virus Movement protein TGB2 (ORF3) in viral infection cycles?

The Lolium latent virus Movement protein TGB2 (ORF3) plays several critical roles in the viral infection cycle:

  • Cell-to-cell movement: The protein facilitates the transport of viral genetic material between adjacent plant cells through plasmodesmata.

  • Membrane association: The hydrophobic domains within the protein enable interaction with cellular membranes, which is essential for creating the transport complexes necessary for viral movement.

  • Interaction with host factors: The protein interacts with specific host proteins, particularly those associated with chloroplast membranes, to facilitate viral movement and potentially suppress host defense responses.

Experimental evidence shows that the N-terminal sequence of LoLV proteins is crucial for efficient cell-to-cell movement, functional systemic movement, protein-protein interactions, and particle formation, though it is not strictly required for virus replication . Mutations that disrupt these functions can significantly impair viral infection, highlighting the protein's importance in viral pathogenesis.

How does the Lolium latent virus Movement protein TGB2 (ORF3) interact with host cellular components?

Research on LoLV proteins has revealed important interactions with host cellular components:

  • Chloroplast association: LoLV coat proteins, which work in conjunction with the movement protein, contain a chloroplast transit peptide (cTP) domain that targets them to chloroplasts in infected tissues .

  • Ankyrin repeat protein interaction: Yeast two-hybrid studies have identified an ankyrin repeat protein in Arabidopsis that interacts with LoLV coat protein. The Nicotiana benthamiana homologue (NbANKr) targets chloroplasts and co-localizes with LoLV coat protein at chloroplast membranes .

  • Functional significance: Silencing of the NbANKr genes in N. benthamiana significantly reduces LoLV viral RNA levels in young leaves compared to control plants, suggesting that this interaction is important for virus movement .

These interactions indicate that TGB2 (ORF3) and other viral proteins exploit host cellular pathways, particularly those associated with chloroplasts, to facilitate viral movement and successful infection.

What experimental approaches are used to study Lolium latent virus Movement protein TGB2 (ORF3) localization and function?

Several complementary experimental approaches have been employed to study the localization and function of Lolium latent virus Movement protein TGB2 (ORF3) and related viral proteins:

  • Transient expression systems: N-terminal deletions of varying lengths are created in the protein sequence and expressed in plant cells to study the effects on intracellular localization .

  • Yeast two-hybrid (Y2H) screening: This approach has been used to identify host proteins that interact with viral proteins, revealing several Arabidopsis proteins with chloroplast-linked pathways .

  • Bimolecular Fluorescence Complementation (BiFC): This technique confirms protein-protein interactions in vivo by visualizing the reconstitution of a fluorescent protein when two interacting proteins tagged with complementary fragments are brought together .

  • Gene silencing: RNA interference (RNAi) is used to silence specific host genes (e.g., NbANKr) to assess their impact on viral infection and movement .

  • Mutational analysis: Site-directed mutagenesis of viral genes in infectious clones, followed by transcript inoculation and monitoring of symptom development, replication, and systemic movement, provides insights into protein function .

  • RT-PCR and Western blotting: These techniques are used to detect viral replication and protein expression in both inoculated and systemic leaves at different time points post-inoculation .

These approaches collectively provide a comprehensive understanding of the protein's role in viral infection and its interactions with host components.

How do mutations in the Lolium latent virus genome affect TGB2 (ORF3) function and viral pathogenesis?

Mutational studies have provided significant insights into the functional domains of LoLV proteins and their impact on viral pathogenesis:

MutationEffect on ProteinImpact on Viral Infection
ATG1 to TTG (K1)Blocks production of 33 kDa CP variantNo systemic infection; virus replication limited to inoculated leaves
ATG2 to TTG (K2)Blocks internal initiation of 28 kDa CPSystemic infection occurs but with altered CP expression pattern
ATG2 to CCC (C3)Completely prevents internal initiationSimilar to K2; suggests 28 kDa CP in K2/C3 infections comes from proteolytic cleavage
Revertant mutations in K1 backgroundPartial restoration of N-terminal domainRestoration of systemic infectivity

The experimental data demonstrate that the N-terminal sequence containing the chloroplast transit peptide is crucial for systemic infection. Interestingly, blocking production of the 28 kDa CP by internal initiation shows no major outcome, whereas mutations that prevent proteolytic cleavage at the chloroplast membrane dramatically affect virus infection . These findings highlight the complex roles of different protein domains in viral movement and pathogenesis.

What is the potential for developing antiviral strategies targeting Lolium latent virus Movement protein TGB2 (ORF3)?

Research on the interaction between LoLV proteins and host factors suggests promising avenues for developing antiviral strategies:

  • Host factor targeting: Silencing of the NbANKr gene in N. benthamiana has been shown to significantly reduce LoLV viral RNA levels in young leaves, suggesting inhibition of virus movement . This approach could potentially be developed into a specific antiviral strategy with minimal impact on plant phenotype.

  • Disruption of chloroplast targeting: Since the chloroplast transit peptide domain is crucial for viral movement and systemic infection, strategies that interfere with chloroplast targeting could effectively inhibit viral spread.

  • Blocking protein-protein interactions: Developing molecules that disrupt the interaction between viral movement proteins and host factors (such as ankyrin repeat proteins) could impair viral movement.

  • Engineering resistant plant varieties: Knowledge of the critical domains in viral movement proteins could guide the development of transgenic plants expressing interferingRNA or proteins that specifically inhibit viral function.

The finding that silencing NbANKr has no obvious effect on plant phenotype but interferes with LoLV infection is particularly promising, as it suggests that targeting specific host-virus interactions may provide effective and selective antiviral strategies with minimal side effects on plant development .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.