Recombinant Lolium perenne Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and additional fees are agreed upon in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
petA; LopeCp052; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
petA
Target Protein Sequence
YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV LANGKKGGLNVGAVLILPEGFELAPPDRISPELKEKIGNLSFQSYRPDKKNILVIGPVPG KKYSEIVFPILSPDPATKKDAYFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATSTGIVK KILRKEKGGYEISIVDASDGRQVIDTIPPGPELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFFASVILAQVFLVLKKKQFEKVQLYEMNF
Uniprot No.

Target Background

Function
Recombinant *Lolium perenne* Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between Photosystem II (PSII) and Photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its role in Lolium perenne?

Apocytochrome f is a chloroplastic protein encoded by the petA gene in the chloroplast genome of Lolium perenne (perennial ryegrass). It functions as a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. The mature protein is formed when a heme group is covalently attached to the apoprotein, creating the functional cytochrome f. In L. perenne, the protein consists of approximately 320 amino acids with a characteristic sequence beginning with YPIFAQQGYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVLRIPYDMQLKQV and contains highly conserved regions that are essential for electron transport functionality .

How does the structure of Lolium perenne Apocytochrome f compare to other species?

The amino acid sequence of L. perenne Apocytochrome f shows significant homology with counterparts from other photosynthetic organisms while maintaining species-specific variations. When compared to Euglena gracilis Apocytochrome f (UniProt: Q8GZR2), both share the characteristic N-terminal YPIFAQQ motif but diverge in subsequent regions. The L. perenne protein (UniProt: A8Y999) contains highly conserved cysteine residues that are crucial for heme attachment and structural integrity . Both proteins maintain the core functional domains required for electron transport, including the heme-binding domain and membrane-anchoring region, though L. perenne's version appears to be more compact with fewer amino acids in certain loop regions.

What expression systems are most effective for producing recombinant L. perenne Apocytochrome f?

While no specific expression system data is available for L. perenne Apocytochrome f in the provided sources, related research on recombinant proteins from L. perenne suggests that E. coli-based expression systems can be effective. For instance, the recombinant allergen Lol p II from L. perenne was successfully expressed in the periplasm of E. coli, yielding high amounts of functional protein that maintained immunological properties similar to the native form . For chloroplastic proteins like Apocytochrome f, a similar approach using periplasmic expression with appropriate signal sequences could be beneficial to facilitate proper folding and disulfide bond formation. Expression optimization would likely require testing multiple constructs with various fusion tags and expression conditions.

What are the optimal conditions for expressing and purifying recombinant L. perenne Apocytochrome f?

Based on analogous recombinant protein production strategies, optimal expression of L. perenne Apocytochrome f would likely involve the following methodological approach: (1) Construct design should include appropriate promoters (T7 or tac) and fusion tags that facilitate purification while maintaining protein functionality; (2) Expression in E. coli strains optimized for membrane or periplasmic proteins, such as BL21(DE3) derivatives with enhanced disulfide bond formation capabilities; (3) Induction at reduced temperatures (16-25°C) to minimize inclusion body formation; (4) Purification using immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography to obtain homogeneous protein preparations . The protein should be maintained in a Tris-based buffer system with 50% glycerol for stability, as indicated for similar recombinant proteins .

How should recombinant L. perenne Apocytochrome f be stored to maintain stability and activity?

Recombinant L. perenne Apocytochrome f should be stored in a Tris-based buffer containing 50% glycerol, optimized specifically for this protein. For short-term storage, working aliquots can be kept at 4°C for up to one week. For longer-term storage, the protein should be stored at -20°C, while extended storage periods require -20°C or preferably -80°C conditions. Repeated freeze-thaw cycles should be strictly avoided to prevent protein degradation and activity loss . Small aliquots should be prepared before freezing to minimize the need for repeated thawing of the entire stock. Addition of reducing agents like DTT or β-mercaptoethanol at low concentrations may help maintain cysteine residues in the reduced state when appropriate for downstream applications.

What analytical methods are most appropriate for characterizing recombinant L. perenne Apocytochrome f?

A comprehensive characterization strategy for recombinant L. perenne Apocytochrome f should employ multiple complementary techniques:

Analytical MethodPurposeKey Parameters
SDS-PAGEPurity assessment and molecular weight confirmation12-15% acrylamide gels, reducing/non-reducing conditions
Western blottingIdentity confirmationAntibodies against conserved cytochrome f epitopes
Size exclusion chromatographyOligomeric state and aggregation assessmentPBS or Tris buffer systems, flow rate 0.5 mL/min
Circular dichroismSecondary structure analysisFar-UV (190-260 nm) spectrum
UV-Visible spectroscopyHeme incorporation verificationAbsorbance at 400-450 nm (Soret band)
Mass spectrometryExact mass and post-translational modificationsESI-MS or MALDI-TOF
Functional assaysElectron transfer capabilityReduction-oxidation potential measurements

Bottom-up proteomic approaches using LC-MS/MS can provide detailed characterization, as demonstrated with other L. perenne proteins . This approach would enable identification of any post-translational modifications and verification of the complete sequence.

How can site-directed mutagenesis be used to investigate the functional domains of L. perenne Apocytochrome f?

Site-directed mutagenesis represents a powerful approach for investigating structure-function relationships in L. perenne Apocytochrome f. Critical residues for targeted mutation include: (1) The conserved cysteine residues involved in heme attachment, to evaluate their contribution to protein stability and electron transfer efficiency; (2) Residues in the large hydrophilic domain that potentially interact with plastocyanin or other electron transport partners; (3) Membrane-anchoring residues to investigate their role in complex assembly and localization in the thylakoid membrane. Each mutant should be characterized using the analytical methods outlined in question 2.3, with particular emphasis on functional electron transfer assays to determine the impact of mutations on photosynthetic electron transport capacity . Comparative analysis with known cytochrome f structures from other species can guide the selection of the most informative mutation sites.

What approaches can be used to investigate the interaction between L. perenne Apocytochrome f and other components of the photosynthetic electron transport chain?

Investigation of protein-protein interactions involving L. perenne Apocytochrome f requires a multi-faceted approach:

  • In vitro binding assays: Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) to measure direct binding between purified recombinant Apocytochrome f and potential interaction partners like plastocyanin.

  • Co-immunoprecipitation studies: Using antibodies against Apocytochrome f to pull down interacting proteins from L. perenne thylakoid preparations, followed by mass spectrometry identification.

  • Cross-linking experiments: Chemical cross-linking coupled with mass spectrometry (XL-MS) to capture transient interactions within the native environment.

  • Functional reconstitution: Incorporation of recombinant Apocytochrome f into liposomes with other purified components of the electron transport chain to measure electron transfer rates under controlled conditions.

These approaches would provide complementary data on both the physical and functional interactions that define the role of Apocytochrome f in the photosynthetic machinery of L. perenne .

How do the antioxidant properties of L. perenne proteins relate to Apocytochrome f function and stability?

Recent research on L. perenne has identified significant ex vivo antioxidant activity in protein fractions from green juice, primarily attributed to enzymes like superoxide dismutase and peroxiredoxin proteoforms . While Apocytochrome f was not specifically identified among these antioxidant proteins, its function within the electron transport chain places it in an environment with high potential for oxidative damage. The protein likely possesses intrinsic structural features that confer resistance to oxidative stress, such as strategic positioning of cysteine residues and aromatic amino acids that can act as radical scavengers. The heme group in the mature cytochrome f may also contribute to redox homeostasis. Understanding these properties is crucial when producing and handling recombinant forms of the protein, as oxidative damage during expression and purification could significantly impact functionality . Further research specifically examining the redox stability of recombinant L. perenne Apocytochrome f would be valuable for optimizing production protocols.

What insights can comparative proteomics provide about L. perenne Apocytochrome f evolution and adaptation?

Comparative proteomics approaches can reveal significant insights about the evolutionary trajectory and adaptive features of L. perenne Apocytochrome f. By comparing sequence conservation, post-translational modifications, and structural features across diverse plant species, researchers can identify both highly conserved functional domains and species-specific adaptations. Recent proteomic characterization of L. perenne has demonstrated the power of such approaches, identifying over 1,000 protein groups across different fractions . For Apocytochrome f specifically, comparative analysis should focus on:

  • Sequence variations in regions interacting with electron transport partners

  • Differences in heme-binding domains that might affect redox potential

  • Species-specific adaptations in membrane-anchoring regions

These analyses could reveal how evolutionary pressures have shaped the protein's function in different photosynthetic organisms and identify features that contribute to L. perenne's specific ecological adaptations.

What potential applications exist for recombinant L. perenne Apocytochrome f in biotechnology and agriculture?

While primarily a fundamental research tool, recombinant L. perenne Apocytochrome f holds potential for several biotechnological and agricultural applications:

  • Photosynthesis enhancement: Knowledge gained from structural and functional studies could inform strategies to engineer more efficient photosynthetic electron transport in crop plants.

  • Biosensor development: The electron transport capabilities of cytochrome proteins can be harnessed to develop biosensors for environmental monitoring or diagnostic applications.

  • Plant stress resilience: Understanding how Apocytochrome f responds to environmental stresses could lead to markers for selecting or developing more resilient grass varieties.

  • Protein-based biorefinery applications: As part of L. perenne protein extraction processes, understanding the properties of abundant chloroplast proteins like Apocytochrome f could improve fractionation and purification strategies in green biorefining .

  • Educational tools: Well-characterized recombinant proteins serve as valuable resources for teaching biochemistry and plant physiology concepts.

These applications represent the translation of fundamental research into practical tools and strategies with potential economic and environmental benefits.

What emerging technologies might advance our understanding of L. perenne Apocytochrome f structure and function?

Several cutting-edge technologies show promise for deepening our understanding of L. perenne Apocytochrome f:

  • Cryo-electron microscopy (cryo-EM): Could provide high-resolution structural insights into the native conformation of Apocytochrome f and its interactions within the cytochrome b6f complex.

  • Single-molecule techniques: Methods such as single-molecule FRET could reveal dynamic aspects of protein function that are masked in ensemble measurements.

  • Advanced mass spectrometry approaches: Cross-linking MS and hydrogen-deuterium exchange MS could map interaction surfaces and conformational changes during function.

  • CRISPR-based genome editing: Precise modification of the petA gene in L. perenne could enable in vivo structure-function studies without the complications of heterologous expression.

  • Artificial intelligence approaches: Machine learning algorithms applied to sequence and structural data could predict functional properties and guide experimental design.

Implementation of these technologies would complement existing biochemical and biophysical approaches to provide a more comprehensive understanding of this important photosynthetic protein .

How might research on L. perenne Apocytochrome f contribute to understanding climate adaptation in forage grasses?

Research on L. perenne Apocytochrome f could provide valuable insights into climate adaptation mechanisms in this economically important forage grass. As a key component of the photosynthetic apparatus, changes in Apocytochrome f structure, expression, or regulation may reflect evolutionary adaptations to different light conditions, temperature ranges, or water availability. Comparative studies of Apocytochrome f variants from L. perenne ecotypes adapted to different climatic conditions could reveal molecular mechanisms underlying environmental resilience. This research could identify specific amino acid substitutions or regulatory changes that confer advantages under changing climate conditions. Such knowledge would be particularly valuable given the agricultural importance of L. perenne as one of the most widely used turf and forage grasses globally . The findings could inform breeding programs aimed at developing more resilient grass varieties capable of maintaining productivity under increasingly variable climate conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.