Recombinant Lolium perenne ATP synthase subunit a, chloroplastic (atpI)

Shipped with Ice Packs
In Stock

Description

Functional Role in Chloroplast ATP Synthase

ATP synthase in chloroplasts comprises two domains:

  • F₀ domain: Membrane-embedded proton channel (subunits a, b, b', c-ring).

  • F₁ domain: Catalytic head for ATP synthesis (α₃β₃γδε subunits) .

The recombinant AtpI (subunit a) facilitates proton transport across the thylakoid membrane via interactions with the c-ring rotor. Proton movement drives rotation of the c-ring, coupling mechanical energy to ATP synthesis in F₁ . Studies in homologous systems suggest AtpI stabilizes the c-ring structure and enhances F₁ membrane association .

Stability and Assembly

  • Deletion of atpI in bacterial models reduced ATP synthase stability, rotor integrity, and ATPase activity by 30–50% .

  • In Lolium perenne, AtpI is among the most abundant ATP synthase subunits identified in chloroplast proteomes, constituting 5.6–7.4% of membrane-associated proteins .

Biotechnological Applications

  • Antigen Production: Used in ELISA kits for antibody generation due to high immunogenicity .

  • Structural Studies: Recombinant AtpI enables in vitro reconstitution experiments to study c-ring stoichiometry and proton transport mechanisms .

  • Stress Response: ATP synthase subunits, including AtpI, are upregulated under oxidative stress, suggesting roles in redox homeostasis .

Comparative Insights

While bacterial AtpI is dispensable for c-ring assembly in some species , chloroplast homologs like L. perenne AtpI are essential for maintaining photosynthetic efficiency. For example:

  • Tomato chloroplast AtpA (α subunit) knockout mutants exhibited impaired ATP synthesis and reduced stress tolerance .

  • In spinach, subunit a collaborates with the c-ring to achieve a proton-to-ATP ratio dependent on c-subunit stoichiometry .

Future Directions

Current research gaps include:

  • Direct evidence of AtpI’s role in L. perenne chloroplast ATP synthase assembly.

  • Structural resolution of the plant F₀ domain using recombinant AtpI .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpI; LopeCp027; ATP synthase subunit a, chloroplastic; ATP synthase F0 sector subunit a; F-ATPase subunit IV
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
atpI
Target Protein Sequence
MNIIPCSIKTLKGLYDISGVEVGQHFYWQIGSFQIHAQVLITSWVVITILLGSVVIAVRN PQTVPMDGQNFFEYVLEFIRDLSKTQIGEEYGPWVPFIGTMFLFIFVSNWSGALLPWKII ELPHGELAAPTNDINTTVALALLTSAAYFYAGLSKKGLSYFEKYIKPTPILLPINILEDF TKPLSLSFRLFGNILADELVVVVLVSLVPLVVPIPVMFLGLFTSGIQALIFATLAAAYIG ESMEGHH
Uniprot No.

Target Background

Function
As a key component of the proton channel, this protein plays a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What methodologies are most effective for studying Lolium perenne proteins, including ATP synthase components?

Several complementary methodologies have proven effective for studying L. perenne proteins:

  • Bottom-up proteomics with LC-MS/MS: This approach enables comprehensive protein identification and quantification through:

    • In-solution digestion using trypsin

    • Protein reduction with TCEP and alkylation with IAA

    • Peptide purification using C-18 StageTips

    • Analysis via nLC-1200 ultra-high-performance liquid chromatography coupled to a Q Exactive HF tandem mass spectrometer

  • Size exclusion chromatography (SEC): This technique effectively fractionates L. perenne proteins based on molecular size before further analysis .

  • Quantitative analysis: Label-free quantification (LFQ) allows determination of differential protein abundance across treatments or fractions .

  • Functional enrichment analysis: GO-term analysis and fraction-based enrichment provide insights into the functional significance of identified proteins .

For ATP synthase components specifically, these methods can identify subunits, characterize post-translational modifications, investigate protein-protein interactions, and examine changes in abundance under different environmental conditions.

How is recombinant Lolium perenne ATP synthase subunit a (atpI) typically expressed and purified for research?

The expression and purification of recombinant L. perenne ATP synthase subunit a involves several methodological steps:

  • Gene cloning: The atpI gene is isolated from L. perenne, amplified, and cloned into an appropriate expression vector.

  • Expression system selection: A suitable host (bacterial, insect, or yeast cells) is chosen based on protein complexity and post-translational modification requirements.

  • Protein expression: The transformed host is cultured under conditions optimized for recombinant protein production.

  • Purification strategy: Multiple chromatography steps are typically employed:

    • Initial capture using affinity chromatography (if tagged)

    • Further purification via ion exchange and/or size exclusion chromatography

    • Quality assessment using SDS-PAGE and mass spectrometry

  • Storage conditions: The purified protein is typically stored in a Tris-based buffer with 50% glycerol at -20°C, or at -80°C for extended storage .

Repeated freezing and thawing should be avoided to maintain protein integrity, with working aliquots stored at 4°C for up to one week .

What experimental applications utilize recombinant Lolium perenne ATP synthase subunit a?

Recombinant L. perenne ATP synthase subunit a has several important research applications:

  • Structural studies: The purified protein can be used for X-ray crystallography or cryo-electron microscopy to elucidate its three-dimensional structure.

  • Enzyme-linked immunosorbent assays (ELISA): As indicated in source , the recombinant protein can be used in ELISA applications for detection and quantification.

  • Reconstitution experiments: The protein can be incorporated into liposomes to study proton translocation and ATP synthesis mechanisms.

  • Antibody production: The recombinant protein serves as an antigen for generating specific antibodies for immunolocalization and Western blotting.

  • Protein-protein interaction studies: Techniques such as pull-down assays, co-immunoprecipitation, or yeast two-hybrid can identify interaction partners.

  • Inhibitor screening: The protein can be used to screen for compounds that specifically interact with ATP synthase, which could potentially lead to the development of new herbicides or therapeutic agents.

How does the expression and function of ATP synthase components change under environmental stress in Lolium perenne?

Environmental stressors significantly impact ATP synthase expression and function in L. perenne as part of the plant's adaptive response mechanisms. Transcriptomic analysis reveals that even low levels of xenobiotic stress induce substantial reprogramming of gene expression patterns.

When L. perenne is exposed to sub-toxic levels of xenobiotics such as glyphosate and tebuconazole, significant changes occur in:

  • Carbohydrate metabolism processes: Affecting the substrate availability for ATP production .

  • Signaling pathways: Particularly those involving SNF1 (sucrose non-fermenting 1)-related kinases, which connect energy sensing to stress responses .

  • Protein-kinase cascades: Including Serine/Threonine-protein kinases that may regulate ATP synthase activity through phosphorylation .

  • Transcriptional regulation: Affecting the expression of genes encoding metabolic enzymes and regulatory proteins .

Methodologically, researchers investigating these changes employ:

  • RNA sequencing for transcriptome-wide analysis

  • qRT-PCR for validation of specific gene expression changes

  • Metabolomic analysis to detect alterations in energy-related metabolites

  • Differential expression analysis using statistical tools like DESeq

These findings indicate that ATP synthase regulation is integrated into broader stress response networks that coordinate energy metabolism with defensive responses, even when the stressors are present at levels that do not cause obvious physiological damage.

What role does ATP synthase play in the antioxidant properties observed in Lolium perenne protein fractions?

Recent research has identified interesting connections between ATP synthase function and antioxidant properties in L. perenne. A 2025 study of fractionated L. perenne green juice protein found that certain protein fractions display significant ex vivo antioxidant activity .

While ATP synthase components were not specifically highlighted among the antioxidant proteins, several mechanisms potentially link ATP synthase to antioxidant capacity:

  • Energy provision for antioxidant systems: ATP synthase generates the ATP required for numerous antioxidant systems, including glutathione regeneration.

  • Redox balance maintenance: The proton gradient that drives ATP synthase also influences reactive oxygen species (ROS) production in chloroplasts.

  • Coordination with antioxidant enzymes: The study identified superoxide dismutase and peroxiredoxin proteoforms in fractions with increased antioxidant activity, suggesting coordinated function with energy metabolism .

Methodologically, researchers investigating this relationship use:

  • Size exclusion chromatography to fractionate proteins

  • In vitro antioxidant activity assays

  • Quantitative bottom-up proteomics to identify proteins in active fractions

  • GO-term analysis to understand functional relationships

The study provides the most detailed characterization of the L. perenne proteome to date and offers insights into protein-level partitioning during wet fractionation, which has implications for both fundamental understanding of plant biochemistry and applied aspects of green biorefining .

How can computational modeling predict the effects of mutations in the atpI gene on ATP synthase function?

Computational modeling provides powerful approaches to predict how mutations in the atpI gene might affect ATP synthase function in L. perenne, guiding experimental work and providing mechanistic insights.

A comprehensive computational analysis workflow includes:

  • Homology modeling: Construction of a structural model based on the 247-amino acid sequence from L. perenne ATP synthase subunit a using homologous proteins with known structures as templates.

  • Molecular dynamics simulations: These can predict how specific mutations might affect:

    • Protein stability and transmembrane organization

    • Proton channel geometry and conductance

    • Interactions with other ATP synthase subunits

    • Conformational dynamics during catalysis

  • Electrostatic analysis: Calculation of the electrostatic properties around key residues involved in proton translocation to predict how mutations might alter function.

  • In silico mutagenesis: Systematic analysis of the effects of specific amino acid substitutions on structure and predicted function.

  • Evolutionary conservation analysis: Identifying highly conserved residues across species, which are likely crucial for function and would have significant effects if mutated.

Analysis TypeSoftware ToolsKey ParametersOutput Metrics
Homology ModelingMODELLER, SWISS-MODELSequence identity, template qualityRMSD, DOPE score
Molecular DynamicsGROMACS, NAMDSimulation time, force fieldRMSD, hydrogen bonds, water accessibility
Electrostatic AnalysisAPBS, DelPhiGrid resolution, dielectric constantPotential energy maps
Conservation AnalysisConSurf, Evolutionary TraceMultiple sequence alignmentConservation scores

The predictions generated through computational modeling can guide targeted experimental studies, such as site-directed mutagenesis and functional assays, to verify the predicted effects.

How do post-translational modifications regulate ATP synthase function in Lolium perenne under different physiological conditions?

Post-translational modifications (PTMs) play crucial roles in regulating ATP synthase function in L. perenne, allowing for rapid adaptation to changing physiological conditions. Although specific data on PTMs of L. perenne atpI were not directly provided in the search results, several regulatory mechanisms can be inferred from research on ATP synthase and L. perenne proteins.

Key PTMs likely affecting ATP synthase function include:

  • Phosphorylation: Likely mediated by Serine/Threonine-protein kinases, which were identified as differentially regulated under xenobiotic stress in L. perenne . Phosphorylation may affect:

    • Proton channel conductance

    • Interactions between subunits

    • Assembly/disassembly of the complex

  • Redox modifications: Particularly important in chloroplasts where changing light conditions alter the redox environment:

    • Thiol-disulfide exchanges

    • Glutathionylation

    • Nitrosylation

  • Acetylation: May regulate ATP synthase in response to metabolic status.

Research methodologies to investigate these PTMs include:

  • Mass spectrometry-based PTM mapping: The bottom-up proteomics approach described for L. perenne can be adapted with specific enrichment strategies for phosphopeptides, acetylated peptides, or oxidized proteins.

  • Site-directed mutagenesis: Modifying potential PTM sites to either prevent modification or mimic constitutive modification.

  • Activity assays under different conditions: Comparing ATP synthase activity across different physiological states to correlate with PTM profiles.

What methodologies are most effective for studying the in vivo dynamics of ATP synthase in Lolium perenne chloroplasts?

Studying the in vivo dynamics of ATP synthase in L. perenne chloroplasts requires sophisticated methodologies that can capture real-time functional changes without disrupting the native cellular environment. The most effective approaches include:

  • Non-invasive spectroscopic techniques:

    • Chlorophyll fluorescence analysis: Measures photosynthetic parameters linked to thylakoid energization and ATP synthase activity

    • Electrochromic shift (ECS) measurements: Quantifies the electric field across the thylakoid membrane, reflecting proton motive force

    • P700 redox kinetics: Monitors electron transport chain function, which is coupled to ATP synthesis

  • Genetically encoded biosensors:

    • ATP sensors based on fluorescent proteins

    • pH-sensitive fluorescent proteins targeted to chloroplast compartments

    • FRET-based sensors for conformational changes

  • Advanced microscopy techniques:

    • Fluorescence lifetime imaging microscopy (FLIM)

    • Single-molecule tracking

    • Super-resolution microscopy of labeled ATP synthase components

  • Isotope labeling approaches:

    • Real-time measurements of O2 and CO2

    • 31P-NMR to monitor ATP synthesis rates

    • Metabolic flux analysis using stable isotopes

  • Integrated multi-omics:

    • Combining transcriptomics, proteomics, and metabolomics data as demonstrated in L. perenne research

    • Correlating gene expression changes with metabolic adjustments under different conditions

These methodologies can be particularly powerful when applied to study ATP synthase dynamics under environmental stresses, which have been shown to trigger significant changes in energy metabolism and signaling pathways in L. perenne .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.