Recombinant Lolium perenne Chloroplast envelope membrane protein (cemA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

The cemA protein in L. perenne is encoded by the chloroplast genome and localized to the inner envelope membrane. The recombinant variant (UniProt ID: A8Y9I1) includes a full-length sequence (1–230 amino acids) with an N-terminal 10×His tag for purification .

Key sequence features:

  • N-terminal signal peptide: Facilitates membrane integration.

  • Transmembrane domains: Four predicted helices critical for membrane anchoring .

  • Catalytic motifs: Highly conserved histidine residues implicated in ion transport .

Table 2: cemA Homologs Across Species

SpeciesUniProt IDLength (aa)Key Features
Oenothera biennis-214Four TMS; His-tagged
Barbarea vernaA4QKB722990% purity; lyophilized stability
Nephroselmis olivaceaQ9TKZ2392Extended C-terminus; algal-specific motifs

Research Applications

  • Membrane Biogenesis: Used to study cotranslational targeting mechanisms in chloroplasts .

  • CO₂ Transport Assays: Functional complementation tests in cyanobacterial mutants .

  • Protein-Protein Interaction Studies: Partnered with cystatins (e.g., LpCys1) to explore protease regulation .

Challenges and Future Directions

  • Structural Resolution: No crystallographic data exists; cryo-EM studies could elucidate TMS topology.

  • In Planta Validation: Current data rely on heterologous systems; transgenic L. perenne models are needed.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request based on availability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize the development of that tag.
Synonyms
cemA; LopeCp051; Chloroplast envelope membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
cemA
Target Protein Sequence
MKKKKALPSLLYLVFIVLLPWGVSFSFNKCLELWIKNWWNTRQSETLLPYIQEKRILERF IELEELSLLDEMIKEKLKTHAQKPPIGIHKEIIQLVKMDNEDHLHIILHFSTNIICLAIL SGFFFLSKEELVILNSWVQEFFYNLNDSIKAFFILLVTDFFVGFHSTRGWELVIRWVYND LGWAPNELIFTIFVCSFPVILDTCLKFWVFFCLNRLSPSLVVIYHSISEA
Uniprot No.

Target Background

Function
This protein may be involved in proton extrusion. It indirectly contributes to efficient inorganic carbon uptake into chloroplasts.
Protein Families
Cema family
Subcellular Location
Plastid, chloroplast inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What are the methodological considerations for heterologous expression of recombinant cemA?

    Heterologous expression of recombinant cemA requires careful consideration of several factors:

    • Expression system selection: For membrane proteins like cemA, eukaryotic expression systems such as Pichia pastoris have proven effective for chloroplast proteins from Lolium perenne . This system has been successfully used for other chloroplast proteins such as fructosyltransferases.

    • Vector design: The expression vector should include appropriate tags for purification (the tag type will be determined during the production process) and codon optimization for the selected expression system .

    • Solubilization strategy: As a membrane protein, cemA requires careful solubilization. Storage in Tris-based buffer with 50% glycerol optimized for this protein maintains stability .

    • Storage conditions: Store at -20°C for extended storage; working aliquots can be maintained at 4°C for up to one week. Repeated freezing and thawing should be avoided .

    • Verification methods: Functional assessment through reconstitution assays and interaction studies with predicted partners (ycf4, ccsA) should be performed to verify proper folding and activity .

  • How can genetic transformation techniques be applied to study cemA function in Lolium perenne?

    Studying cemA function through genetic transformation in Lolium perenne can be accomplished through several approaches:

    1. Agrobacterium-mediated transformation: An established protocol involves:

      • Using axillary bud-derived embryogenic calli as explants

      • Co-cultivation with Agrobacterium tumefaciens strain AGL0

      • 48h post-cultivation in liquid callus medium with timentin at 10°C

      • Selection using appropriate markers (e.g., paromomycin)

      • Complete regeneration within 4 months with 8-16% success rate

    2. Protoplast-based transient expression:

      • Isolation of protoplasts from 14-day-old leaf mesophyll cells

      • PEG-mediated transformation for transient expression

      • Allows rapid screening of cemA variants or CRISPR guides targeting cemA

    3. CRISPR/Cas9 genome editing:

      • Can be implemented through Agrobacterium delivery

      • Allows precise modification of the cemA locus to study function

    These approaches can be used to create cemA variants, knockdowns, or knockout lines to assess the protein's role in chloroplast function and carbon fixation.

  • What methodologies are appropriate for analyzing cemA-related phenotypes in transgenic Lolium perenne?

    Analyzing cemA-related phenotypes requires multifaceted approaches:

    1. Photosynthetic efficiency measurements:

      • Pulse-amplitude modulation (PAM) fluorometry to assess photosystem II efficiency

      • Gas exchange measurements to quantify carbon assimilation rates

      • Chlorophyll fluorescence imaging to detect spatial heterogeneity in photosynthetic activity

    2. Carbon fixation analysis:

      • 14C-labeling experiments to track carbon assimilation and allocation

      • Mass spectrometry to analyze metabolite profiles

    3. Chloroplast ultrastructure studies:

      • Transmission electron microscopy to examine chloroplast envelope integrity

      • Immunogold labeling to localize cemA within the chloroplast envelope

    4. Molecular phenotyping:

      • RNA-seq to identify transcriptional changes in cemA-modified plants

      • Proteomics to detect alterations in chloroplast protein composition

      • Co-immunoprecipitation to verify predicted protein interactions (e.g., with ycf4, ccsA)

    5. Physiological stress responses:

      • Drought stress tolerance assessment

      • High light stress experiments

      • Temperature stress response analysis

  • How does the evolution of cemA in Lolium perenne compare to other Poaceae species, and what are the implications for functional studies?

    Evolutionary analysis of cemA reveals significant insights:

    Comparative studies of chloroplast genomes show that the cemA gene is located in highly conserved syntenic blocks across Poaceae species, but with subtle sequence variations . The SSC and LSC regions of chloroplast genomes, where cemA is located, show higher divergence than IR regions across species in the Poaceae family .

    Sliding window analysis of nucleotide diversity in related Festuca species shows variable rates of evolution across different chloroplast genes . Understanding these evolutionary patterns is critical when:

    1. Designing cross-species complementation experiments

    2. Interpreting functional conservation and divergence

    3. Selecting appropriate regions for targeted mutagenesis

    4. Developing evolutionary models of chloroplast membrane protein function

    Researchers should account for these evolutionary patterns when designing primers for amplification, selecting expression systems, and interpreting functional data across species.

  • What techniques can be used to study cemA protein-protein interactions in the chloroplast envelope?

    Several advanced techniques can be employed to study cemA interactions:

    1. Split-GFP complementation:

      • Fusion of cemA and potential interactors with complementary GFP fragments

      • Reconstitution of fluorescence upon interaction

      • Can be performed in protoplast transient expression systems

    2. Co-immunoprecipitation coupled with mass spectrometry:

      • Expression of tagged cemA in transgenic plants

      • Isolation of chloroplast envelope membranes

      • Immunoprecipitation and identification of interacting partners

    3. Yeast two-hybrid membrane system adaptations:

      • Modified for membrane proteins

      • Screening of interaction partners from chloroplast protein libraries

    4. Förster resonance energy transfer (FRET):

      • Fusion of cemA and candidate interactors with appropriate fluorophores

      • Detection of energy transfer indicating close proximity and interaction

    5. Bimolecular fluorescence complementation (BiFC):

      • Similar to split-GFP but with different fluorescent protein variants

      • Allows visualization of interaction sites within the chloroplast

  • How can RNA editing sites in cemA transcripts be identified and what is their functional significance?

    The Lolium perenne chloroplast genome exhibits RNA editing, with 31 mRNA editing sites identified across various transcripts, including potentially in cemA . To identify RNA editing sites in cemA:

    1. RT-PCR and sequencing:

      • Extract total RNA from Lolium perenne tissues

      • Synthesize cDNA using cemA-specific primers

      • Sequence the RT-PCR products and compare with genomic DNA sequence

      • Any differences (typically C-to-U conversions) indicate RNA editing sites

    2. RNA-seq approach:

      • Perform deep sequencing of chloroplast transcripts

      • Map reads to the cemA genomic sequence

      • Identify consistent mismatches indicating editing events

    Functional significance can be assessed by:

    • Creating transgenes with edited/non-edited versions of cemA

    • Introducing mutations at editing sites to prevent editing

    • Comparing protein stability, localization, and function between edited and non-edited versions

    RNA editing in chloroplast transcripts often restores conserved amino acids, creates start/stop codons, or alters protein properties, all of which may be critical for cemA function.

  • What are the challenges in purifying functional recombinant cemA protein for structural studies?

    Purifying functional cemA for structural studies presents several challenges:

    1. Membrane protein solubilization:

      • Selection of appropriate detergents that maintain protein structure

      • Optimization of lipid environment to preserve function

      • Avoiding protein aggregation during extraction

    2. Expression system optimization:

      • Eukaryotic systems may be necessary for proper folding

      • Codon optimization for high-yield expression

      • Temperature and induction conditions require careful tuning

    3. Purification strategy development:

      • Multi-step purification to achieve high purity

      • Tag design that doesn't interfere with structure or function

      • Maintaining protein stability throughout purification

    4. Structural integrity verification:

      • Circular dichroism to assess secondary structure

      • Limited proteolysis to confirm proper folding

      • Functional assays to verify activity post-purification

    5. Crystallization challenges:

      • Identifying conditions compatible with membrane proteins

      • Lipid cubic phase crystallization may be necessary

      • Alternative approaches like cryo-EM might be more suitable

    Researchers have successfully employed similar strategies for other chloroplast envelope proteins and these approaches can be adapted for cemA purification.

  • How can high-throughput phenotypic screening be used to identify Lolium perenne lines with altered cemA function?

    High-throughput phenotypic screening for cemA function can employ:

    1. Chlorophyll fluorescence imaging platforms:

      • Automated imaging of photosystem II efficiency (Fv/Fm)

      • Detection of subtle photosynthetic phenotypes

      • Screening hundreds/thousands of plants simultaneously

    2. Infrared gas analysis systems:

      • Measurement of CO2 uptake rates

      • Assessment of carbon fixation efficiency

      • Identification of lines with altered inorganic carbon uptake

    3. Growth rate analysis under controlled conditions:

      • Time-lapse imaging of plant growth

      • Biomass accumulation measurement

      • Response to varying CO2 concentrations

    4. Stress response screening:

      • High light tolerance assessment

      • CO2 limitation response

      • Temperature stress survival

    5. Molecular screening approaches:

      • TILLING (Targeting Induced Local Lesions in Genomes) for identifying chemically induced mutations in cemA

      • PCR-based screening for natural variants in cemA sequence

      • RNA expression level analysis through qRT-PCR

  • What are the implications of cemA function for enhancing photosynthetic efficiency in Lolium perenne breeding programs?

    Understanding cemA function has significant implications for breeding programs:

    1. Carbon concentration mechanism optimization:

      • cemA's role in proton extrusion and inorganic carbon uptake makes it a target for enhancing carbon fixation efficiency

      • Variants with improved function could increase photosynthetic rates

    2. Stress tolerance improvement:

      • Altered cemA function may enhance performance under drought or heat stress

      • Selection for optimal cemA variants could improve resilience

    3. Integration with other breeding targets:

      • Combining cemA optimization with improvements in other photosynthetic genes

      • Balancing carbon fixation with water use efficiency

    4. Molecular marker development:

      • SNPs in cemA or associated genes could serve as markers for selection

      • Chloroplast haplotype analysis including cemA variants for cytoplasmic breeding pools

    5. Transgenic approaches:

      • Engineering optimized cemA variants through transformation protocols

      • CRISPR/Cas9 editing of cemA to introduce beneficial mutations

    Such approaches could contribute to developing Lolium perenne varieties with enhanced photosynthetic efficiency for agricultural applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.