Recombinant Lolium perenne Cytochrome c biogenesis protein ccsA (ccsA)

Shipped with Ice Packs
In Stock

Description

Transcriptomic Analysis Under Cadmium Stress

A 2022 study analyzed Lolium perenne exposed to cadmium (Cd) stress, revealing differential gene expression patterns :

Cd Concentration (µM)Unique DEGsKey Pathways Affected
0 (Control)1,793Baseline photosynthesis regulation
501,481Stress signaling, detoxification
5001,374Heavy metal ion binding, apoptosis

Principal Component Analysis (PCA) showed distinct clustering of gene expression profiles across treatments, with PC1 (14.66%) and PC2 (13.48%) explaining 28.14% of total variance . The ccsA gene exhibited stable expression under moderate Cd stress but showed downregulation at 500 µM Cd, suggesting impaired cytochrome c assembly under severe metal toxicity .

Comparative Analysis with Orthologs

The L. perenne ccsA shares functional similarities with homologs in other species:

SpeciesProtein LengthKey Feature
Chloranthus spicatus312 aaConserved heme-binding motifs
Brachypodium distachyon328 aaExtended C-terminal domain
Synechococcus sp.295 aaSimplified transmembrane architecture

These variants retain the core heme ligation activity but differ in auxiliary domains influencing membrane localization .

Applications in Biotechnology

  • Phytoremediation studies: Used to assess cytochrome c dynamics in plants exposed to heavy metals like Cd .

  • Photosynthesis research: Critical for analyzing electron transport chain efficiency in genetically modified grasses .

  • Protein interaction assays: Serves as a scaffold to study CcsA-CcsB complex formation in vitro .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
Before opening, we recommend briefly centrifuging the vial to ensure the contents settle to the bottom. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our products is influenced by several factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development during the production process.
Synonyms
ccsA; LopeCp105; Cytochrome c biogenesis protein CcsA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
ccsA
Target Protein Sequence
MLFATLEHILNHISFSTISIVITIHLITLLVHELGGLRDSSEKGMIVTFFSITGFLVSRW ASSGHFPLSNLYESLIFLSWALYILHTIPKIQNSKNDLSTITTPSTILTQGFATSGLLTE MHQSTILVPALQSQWLMMHVSMMLLSYATLLCGSLLSAAILIIRFRNNFFFFSKKKKNVL LKTFFFSDFYVKRSSLKSTSVPSFPNYYKYQLTERLDSWSYRVISLGFTLLTIGILCGAV WANDAWGSYWNWDPKETWAFITWTIFAIYLHSRTNLNWKGTNSALVASIGFLIIWICYFG INLLGIGLHSYGSFILTSK
Uniprot No.

Target Background

Function
Plays a crucial role in the biogenesis of c-type cytochromes (cytochrome c6 and cytochrome f) by facilitating heme attachment.
Protein Families
CcmF/CycK/Ccl1/NrfE/CcsA family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is cytochrome c biogenesis protein ccsA in Lolium perenne?

The ccsA protein is a transmembrane component of the cytochrome c biogenesis system II pathway in Lolium perenne (perennial ryegrass). It functions as part of a membrane complex with CcsB that facilitates heme delivery and attachment to c-type cytochromes in the periplasmic space . The protein has a sequence length spanning region 1-319 and contains multiple transmembrane domains that anchor it within the membrane . As part of the system II biogenesis pathway, ccsA is essential for proper energy metabolism and electron transport in the plant.

What are the structural characteristics of recombinant Lolium perenne ccsA?

Recombinant Lolium perenne ccsA is typically produced with an N-terminal 10xHis-tag to facilitate purification and detection . The full protein sequence contains 319 amino acids and features multiple transmembrane segments that are critical for its integration into biological membranes . Structurally, the protein contains regions responsible for heme binding and interaction with partner proteins like CcsB. The sequence includes characteristic motifs that are conserved across species utilizing the system II pathway for cytochrome c biogenesis.

How does cytochrome c biogenesis system II differ from system I?

System II (which includes ccsA) requires fewer components than system I, which utilizes eight genes (ccmA-H) in organisms like Escherichia coli . A key functional difference is that system I can utilize endogenous heme at much lower levels than system II, providing an adaptive advantage in low-heme environments . Additionally, system I encodes a covalently bound heme chaperone (holo-CcmE) that serves as a heme reservoir, a capability that system II does not possess . This fundamental difference affects experimental approaches when studying ccsA function, as heme availability must be carefully considered.

What is the optimal storage and handling of recombinant ccsA protein?

For optimal preservation, recombinant Lolium perenne ccsA should be stored at -20°C for routine use, or at -80°C for extended storage . Repeated freezing and thawing should be avoided to maintain protein integrity . For working solutions, aliquots can be maintained at 4°C for up to one week to minimize degradation . The shelf life is approximately 6 months for liquid preparations and up to 12 months for lyophilized forms when stored at -20°C/-80°C .

What methods are effective for studying ccsA-ccsB interactions?

To investigate the critical interaction between ccsA and ccsB in the biogenesis complex, researchers should employ multiple complementary approaches:

  • Co-immunoprecipitation using the N-terminal His-tag on recombinant ccsA

  • Crosslinking studies followed by mass spectrometry

  • Yeast two-hybrid or bacterial two-hybrid systems

  • Bimolecular fluorescence complementation in plant protoplasts

  • Surface plasmon resonance to determine binding kinetics

These techniques provide insights into the structural basis of the ccsA-ccsB interaction that is critical for heme delivery and cytochrome c maturation. Research has demonstrated that the ccsA-ccsB complex (or a fused ccsBA polypeptide) can replace the function of all eight system I genes in heterologous systems, highlighting the functional significance of this interaction .

How can researchers assess ccsA functionality in experimental systems?

Functionality of ccsA can be evaluated through several experimental approaches:

MethodMeasurementAdvantagesLimitations
Complementation assaysRestoration of cytochrome c functionTests in vivo functionRequires a suitable deficient host
Spectroscopic analysisHeme attachment to cytochrome cQuantitative, direct measurementRequires purified components
Oxygen consumptionElectron transport activityMeasures physiological outcomeMultiple factors can affect results
Reporter systemsCytochrome-dependent outputsCan be high-throughputMay introduce artifacts

Researchers have successfully used reporter systems like B. pertussis cytochrome c4 to demonstrate that a single fused ccsBA polypeptide can functionally replace the eight system I genes in E. coli . This approach allows for direct comparison of different biogenesis systems within the same host organism.

What expression systems are optimal for producing functional recombinant ccsA?

Successful expression of functional ccsA requires careful consideration of the expression system:

  • E. coli-based systems with specialized strains for membrane proteins

  • Cell-free expression systems with membrane mimetics

  • Baculovirus-insect cell systems for higher eukaryotic protein folding

  • Plant-based expression systems for native post-translational modifications

The choice should be guided by the experimental objectives, as each system offers different advantages. The in vitro E. coli expression system has been documented as effective for producing recombinant Lolium perenne ccsA , though modifications to standard protocols may be necessary to accommodate the transmembrane nature of the protein.

What are the challenges in purifying functional transmembrane ccsA protein?

Purification of functional ccsA presents several technical challenges:

  • Maintaining native membrane protein conformation during solubilization

  • Preventing aggregation of hydrophobic transmembrane domains

  • Selecting appropriate detergents that preserve protein-protein interactions

  • Developing protocols that retain heme-binding capabilities

Methodological approaches to address these challenges include:

  • Using mild, non-ionic detergents like DDM or LMNG

  • Incorporating nanodiscs or amphipols to provide a membrane-like environment

  • Adding stabilizing agents such as glycerol or specific lipids

  • Employing gentle purification methods with minimal exposure to harsh conditions

The N-terminal 10xHis-tag incorporated in recombinant constructs facilitates purification through immobilized metal affinity chromatography, while careful buffer optimization is essential for maintaining functionality .

How does environmental context affect ccsA expression and function in Lolium perenne?

Environmental factors significantly impact ccsA expression and function in Lolium perenne:

  • Temperature regulation: Vernalization in Lolium perenne requires approximately 80 days of cold exposure, affecting gene expression patterns .

  • Soil composition: Lolium perenne can accumulate various trace elements with different bioaccumulation coefficients, potentially affecting protein function .

  • Growth conditions: As a hardy grass species that adapts to various soil types, Lolium perenne may regulate ccsA expression differently based on growing conditions .

Researchers investigating ccsA should consider these environmental variables when designing experiments, particularly when comparing results across different studies or growth conditions.

How can ccsA research contribute to understanding rare trace element accumulation in Lolium perenne?

Lolium perenne demonstrates varying capacities to accumulate rare trace elements (RTEs) like Be, Ga, In, La, Ce, Nd, and Gd, with bioaccumulation coefficients ranging from 0.0030-0.95 . This accumulation may affect metalloproteins like cytochromes and their biogenesis pathways. Research on ccsA can examine:

  • The impact of RTEs on heme coordination and cytochrome assembly

  • Potential competitive inhibition by non-physiological metals

  • Adaptive responses in the cytochrome biogenesis pathway under metal stress

  • Correlation between ccsA expression and plant tolerance to RTEs

Such studies could provide valuable insights into both fundamental biochemistry and applied aspects of metal tolerance in agricultural settings.

What transcriptomic approaches can reveal ccsA regulation during vernalization?

Vernalization in Lolium perenne takes approximately 80 days and involves significant changes in gene expression patterns . Studies using cDNA microarray approaches have identified cold-responsive genes with different expression patterns:

  • Rapid response genes (cold stress-related)

  • Genes down-regulated toward the end of cold periods

  • Genes up-regulated during extended cold exposure (potential vernalization markers)

Similar approaches could be applied to study ccsA regulation during vernalization, potentially revealing connections between energy metabolism remodeling and flowering transitions. Transcription factor families like MADS box, CONSTANS-like, and JUMONJI have been implicated in vernalization-induced flowering , and investigations into their potential regulation of ccsA could yield valuable insights.

How does the comparative analysis of system I and system II inform experimental design?

Understanding the functional differences between cytochrome c biogenesis systems is crucial for experimental design:

FeatureSystem ISystem II (includes ccsA)Experimental Implications
ComponentsEight proteins (ccmA-H)Four proteins (CcsB, CcsA, DsbD, CcsX)Simpler genetic manipulation in system II
Heme utilizationEfficient at low heme levelsRequires higher heme levelsHeme concentration critical in functional assays
Heme chaperoneContains covalent heme chaperoneNo covalent intermediateDifferent mechanisms of heme delivery
Reservoir capacityCan use holo-CcmE as reservoirNo reservoir capabilitySystem II more sensitive to heme fluctuations

Experiments using the ferrochelatase inhibitor N-methylprotoporphyrin to modulate heme levels have demonstrated these differential capabilities, informing approaches to studying ccsA function .

What are promising approaches for genetic manipulation of ccsA in Lolium perenne?

Advanced genetic approaches applicable to ccsA research include:

  • CRISPR-Cas9 gene editing to create knockouts or specific mutations

  • RNA interference strategies to modulate expression levels

  • Inducible expression systems to study temporal effects

  • Fluorescent protein fusions for localization studies

  • Site-directed mutagenesis to identify critical functional residues

These methodologies could address fundamental questions about ccsA structure-function relationships while contributing to broader understanding of energy metabolism in plants.

How might artificial intelligence approaches enhance ccsA research?

Emerging computational methodologies offer powerful tools for ccsA research:

  • Protein structure prediction using deep learning algorithms to model transmembrane domains

  • Molecular dynamics simulations to study protein-protein and protein-heme interactions

  • Network analysis to place ccsA in broader metabolic contexts

  • Machine learning approaches to identify patterns in expression data across environmental conditions

  • Computational design of modifications to enhance protein stability or function

These approaches complement experimental work and can generate testable hypotheses that would be difficult to formulate through traditional methods alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.