Recombinant Lolium perenne NAD (P)H-quinone oxidoreductase subunit 3, chloroplastic

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Lolium perenne NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, is a protein derived from perennial ryegrass (Lolium perenne) and is a component of the NAD(P)H dehydrogenase (NDH) complex found in chloroplasts . The NDH complex is involved in the transfer of electrons from NAD(P)H to quinones in the photosynthetic electron transport chain .

General Information

  • Name: Recombinant Lolium perenne NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic

  • Source Organism: Lolium perenne (Perennial ryegrass)

  • Synonyms: NAD(P)H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3

  • Gene Name: ndhC

  • Function: Part of the NAD(P)H dehydrogenase (NDH) complex, which participates in electron transport in photosynthesis .

  • Enzyme Classification: EC 1.6.5.-

Function and Mechanism

NAD(P)H-quinone oxidoreductases (NQOs) are a class of enzymes that catalyze the two-electron reduction of quinones and a wide range of other organic compounds .

Key aspects of their function include:

  • Redox Cycling: NQOs can reduce quinones to prevent the formation of reactive semiquinones .

  • Detoxification: They play a role in the detoxification of xenobiotics .

  • Antioxidant Activity: NQOs help reduce the free radical load in cells .

  • Electron Transport: In chloroplasts, the NDH complex, which includes subunit 3, is involved in transferring electrons from NAD(P)H to quinones, contributing to the photosynthetic electron transport chain .

Quinone Oxidoreductase 1 (NQO1)

NAD(P)H quinone oxidoreductase 1 (NQO1) is a cytosolic enzyme that catalyzes the reduction of quinones and other compounds, functioning as a homodimer with two active sites . NQO1 requires a tightly bound FAD cofactor and can use NADH or NADPH with nearly equal efficiency .

Potential Applications

Lolium perenne NAD(P)H-quinone oxidoreductase subunit 3, chloroplastic, and related NQO1 enzymes have several potential applications:

  • Biorefining: Understanding the properties of endogenous proteins with antioxidant activity can help optimize green biorefining processes .

  • Drug Targets: NQO1 is often over-expressed in cancer cells, making it a potential drug target .

  • Therapeutic Uses: NQO1's role in producing $$NAD^+$$ may have therapeutic benefits in managing various diseases .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering. We will accommodate your request to the best of our ability.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ndhC; LopeCp043; NAD(PH-quinone oxidoreductase subunit 3, chloroplastic; NAD(PH dehydrogenase subunit 3; NADH-plastoquinone oxidoreductase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-120
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
ndhC
Target Protein Sequence
MFLLHEYDIFWTFLIIASLIPILAFWISGLLAPVSEGPEKLSSYESGIEPMGGAWLQFRI RYYMFALVFVVFDVETVFLYPWAMSFDVLGVSVFIEAFIFVLILVVGLVYAWRKGALEWS
Uniprot No.

Target Background

Function
NDH (NAD(P)H-quinone oxidoreductase) shuttles electrons from NAD(P)H:plastoquinone, utilizing FMN and iron-sulfur (Fe-S) centers, to quinones within the photosynthetic electron transport chain and potentially the chloroplast respiratory chain. In this species, the primary electron acceptor is believed to be plastoquinone. NDH couples this redox reaction to proton translocation, thereby conserving redox energy as a proton gradient.
Protein Families
Complex I subunit 3 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

How does NAD(P)H-quinone oxidoreductase contribute to stress response mechanisms in Lolium perenne?

When Lolium perenne is exposed to saline stress, several coordinated responses occur:

  • Photosynthetic adaptations: Contents of chlorophyll a, b, and carotenoid significantly decrease under saline treatments compared to control conditions .

  • Antioxidant system modulation: Activities of superoxide dismutase and peroxidase decrease while contents of glutathione and malondialdehyde increase during saline stress . These changes reflect the plant's attempt to manage increased reactive oxygen species production.

  • Transcriptional regulation: Transcriptome analysis has identified 792 differentially expressed genes in Lolium perenne under saline stress . This suggests comprehensive reprogramming of cellular processes, including electron transport chains where NAD(P)H-quinone oxidoreductase functions.

The NAD(P)H-quinone oxidoreductase complex helps maintain electron flow under stress conditions, preventing excessive ROS formation and contributing to energy balance when normal photosynthetic processes are compromised.

What are the optimal storage and handling conditions for recombinant NAD(P)H-quinone oxidoreductase subunit 3?

For optimal stability and activity, recombinant NAD(P)H-quinone oxidoreductase subunit 3 from Lolium perenne should be stored at -20°C, and for extended storage periods, conservation at -80°C is recommended. The protein is typically provided in a Tris-based buffer with 50% glycerol, which has been optimized for protein stability .

Key handling guidelines for researchers include:

  • Avoid repeated freezing and thawing cycles, as these can lead to protein denaturation and loss of activity.

  • Store working aliquots at 4°C for no longer than one week to maintain activity.

  • When first receiving the protein, prepare small single-use aliquots to minimize freeze-thaw cycles.

  • Maintain proper cold chain during all handling procedures.

  • Prior to experimental use, briefly centrifuge the protein solution to collect any condensation on tube walls.

  • For especially sensitive experiments, consider adding stabilizing agents such as reducing agents (DTT or β-mercaptoethanol) to prevent oxidation of susceptible residues .

Following these storage and handling protocols will help ensure the integrity and functionality of the recombinant protein for research applications.

How can transcriptomic approaches be applied to investigate NAD(P)H-quinone oxidoreductase expression under environmental stress?

Transcriptomic analysis provides powerful insights into NAD(P)H-quinone oxidoreductase expression patterns in Lolium perenne under various environmental stressors. Based on established methodologies, the following comprehensive approach is recommended:

  • Experimental design considerations:

    • Establish clearly defined stress treatments (e.g., salinity gradients from 0.8‰ to 12.8‰)

    • Include multiple time points (early response: 6-24h; acclimation: 3-5 days; long-term: 10-18 days)

    • Maintain consistent growth conditions (temperature: 25°C, relative humidity: 70%, light cycle: 12h:12h at 4400 lux)

    • Separate analysis of different tissues (roots vs. shoots) is critical as expression patterns often differ

  • RNA extraction and quality control:

    • Use specialized RNA extraction protocols optimized for plants with high polysaccharide content

    • Validate RNA integrity using bioanalyzer technology (RIN value >8.0 recommended)

    • Include DNase treatment to remove genomic DNA contamination

  • Sequencing considerations:

    • Illumina paired-end sequencing (150 bp) with >20 million reads per sample provides adequate coverage

    • Include at least 3-4 biological replicates per condition to account for biological variability

    • Consider strand-specific library preparation to distinguish sense and antisense transcripts

  • Bioinformatic analysis workflow:

    • Align reads to the Lolium perenne reference genome/transcriptome

    • Calculate normalized expression values (RPKM/FPKM/TPM)

    • Apply statistical methods like DESeq2 or edgeR for differential expression analysis

    • Perform pathway enrichment analysis (GO, KEGG) to identify biological processes affected

  • Validation experiments:

    • Conduct RT-qPCR validation of key genes including ndhC

    • Use stable reference genes like GAPDH (after confirming expression stability under your conditions)

    • Design primers using Primer-BLAST with careful validation via melting curve analysis

A prior transcriptome analysis of Lolium perenne under saline stress identified 792 differentially expressed genes, demonstrating the power of this approach . When analyzing chloroplast-encoded genes like ndhC, special consideration must be given to their unique transcriptional regulation, which differs from that of nuclear genes.

What are the structural and functional differences between NAD(P)H-quinone oxidoreductase subunit 3 and subunit 4L in Lolium perenne?

NAD(P)H-quinone oxidoreductase subunit 3 (ndhC) and subunit 4L (ndhE) in Lolium perenne exhibit distinct structural and functional characteristics despite both being part of the same enzymatic complex:

Structural comparison:

FeatureSubunit 3 (ndhC)Subunit 4L (ndhE)Significance
Amino acid length120 amino acids101 amino acidsDifferent positioning within complex
Locus locationLopeCp043LopeCp108Different positions in chloroplast genome
UniProt accessionA8Y9H5A8Y9D9Reference for structural annotations
Sequence characteristicsContains transmembrane helicesContains transmembrane helicesBoth are membrane-integrated proteins
Secondary structureMultiple transmembrane domainsFewer transmembrane domainsDifferent membrane topology

Functional differences:

  • Position in the complex: Subunit 3 is typically located at the interface of the membrane domain and peripheral arm of the complex, while subunit 4L is embedded deeper within the membrane domain .

  • Electron transfer role: Subunit 3 is more directly involved in electron transfer pathways due to its strategic position, whereas subunit 4L plays a more structural role in maintaining complex stability and assembly.

  • Quinone interaction: Subunit 3 contains regions that contribute to quinone binding sites, which is critical for the enzyme's catalytic function, while subunit 4L is generally more distant from the actual catalytic center.

  • Conservation patterns: Comparative genomics analyses suggest that subunit 3 sequences are more highly conserved across plant species than subunit 4L, indicating stronger evolutionary constraints on subunit 3 function.

These structural and functional differences significantly impact experimental approaches when studying these proteins, including purification strategies, activity assays, and mutation studies. The distinct roles of these subunits highlight the complex architecture and specialized functions within the NAD(P)H-quinone oxidoreductase complex.

How does the mechanism of Lolium perenne NAD(P)H-quinone oxidoreductase compare to human NQO1 enzyme?

The comparison between Lolium perenne chloroplastic NAD(P)H-quinone oxidoreductase and human NQO1 reveals important mechanistic differences with significant implications for research approaches:

Mechanistic comparison:

FeatureLolium perenne NAD(P)H-quinone oxidoreductaseHuman NQO1Research implications
Cellular locationChloroplasticCytosolicDifferent isolation protocols
Quaternary structureMulti-subunit complexHomo-dimerDifferent structural stability
Cofactor requirementFADFADSimilar spectroscopic properties
Electron transferPart of respiratory chain"Ping pong" mechanismDifferent kinetic analyses
Substrate specificityPrimarily plastoquinoneBroad range of quinonesDifferent substrate panels for assays
Inhibitor sensitivityLess sensitive to dicoumarolHighly sensitive to dicoumarolDifferent control compounds
Physiological rolePhotosynthetic electron transportDetoxification & protein stabilizationDifferent functional assays

Key mechanistic differences:

  • Catalytic mechanism: Human NQO1 functions via a "ping pong" mechanism where NAD(P)H binds first, reduces the FAD cofactor, and is released before the quinone substrate binds . The chloroplastic enzyme functions as part of a larger electron transport chain with more complex electron transfer pathways.

  • Structural dynamics: In human NQO1, Tyrosine-128 and the loop spanning residues 232-236 undergo significant conformational changes during the catalytic cycle, partially occupying the space vacated by departing molecules . Such specific structural dynamics have not been fully characterized in the chloroplastic enzyme.

  • Protein interactions: Human NQO1 has been identified as a 20S proteasome-associated protein that stabilizes p53 and other regulatory proteins , while the chloroplastic enzyme primarily functions in electron transport without known protein stabilization roles.

  • Inhibitor binding: The human enzyme has a well-characterized binding site for inhibitors like dicoumarol , whereas the chloroplastic enzyme's inhibitor binding sites and sensitivity profiles are less well defined.

These mechanistic differences necessitate distinct experimental approaches when studying these enzymes, from purification strategies to activity assays and inhibitor studies. Understanding these differences is crucial for researchers designing comparative studies or adapting protocols from the more extensively studied human enzyme to plant systems.

What are the optimal conditions for expressing and purifying recombinant Lolium perenne NAD(P)H-quinone oxidoreductase subunit 3?

The expression and purification of recombinant Lolium perenne NAD(P)H-quinone oxidoreductase subunit 3 requires specialized approaches due to its chloroplastic origin and membrane-associated nature:

Expression system selection:

  • Bacterial expression:

    • E. coli BL21(DE3) with pET-based vectors, with the chloroplast transit peptide removed

    • Growth at lower temperatures (16-18°C) after induction to improve folding

    • Inclusion of rare codon supplementation (e.g., Rosetta strains) to accommodate plant codon bias

    • Recommended induction with 0.1-0.3 mM IPTG at OD600 of 0.6-0.8

  • Eukaryotic expression alternatives:

    • Insect cell/baculovirus system for improved folding and post-translational modifications

    • Plant-based expression systems (e.g., Nicotiana benthamiana transient expression) for native-like conditions

Purification strategy:

  • Membrane fraction isolation:

    • Cell disruption by sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol

    • Differential centrifugation to isolate membrane fractions (10,000g to remove debris, 100,000g to collect membranes)

    • Membrane solubilization with mild detergents (0.5-1% n-dodecyl-β-D-maltoside or 1% digitonin)

  • Affinity purification:

    • His-tag or Strep-tag purification with detergent-containing buffers

    • Gradual detergent reduction during purification to maintain stability

    • Consider on-column refolding approaches for proteins recovered from inclusion bodies

  • Quality control:

    • SDS-PAGE analysis (expect band at ~13.5 kDa)

    • Western blot with anti-His tag or specific antibodies

    • Mass spectrometry verification of protein identity

    • Spectroscopic analysis for FAD incorporation (absorbance at 450 nm)

  • Storage optimization:

    • Store in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage

    • Prepare single-use aliquots to avoid repeated freeze-thaw cycles

    • Add stabilizing agents such as reducing compounds to prevent oxidation

This comprehensive protocol addresses the challenges associated with expressing and purifying membrane-associated chloroplastic proteins while maintaining their functional integrity for subsequent biochemical and structural studies.

What assays can be used to measure NAD(P)H-quinone oxidoreductase activity in plant samples?

Multiple complementary assays can be employed to measure NAD(P)H-quinone oxidoreductase activity in plant samples, each with specific advantages and limitations:

Spectrophotometric assays:

  • Direct NAD(P)H oxidation assay:

    • Principle: Monitor decrease in NAD(P)H absorbance at 340 nm

    • Buffer: 50 mM potassium phosphate (pH 7.4), 0.1% Triton X-100

    • Substrates: 200 μM NAD(P)H, 50-100 μM quinone (e.g., duroquinone)

    • Controls: Without enzyme, without quinone, with specific inhibitors

    • Calculation: Use extinction coefficient ε₃₄₀ = 6,220 M⁻¹cm⁻¹ for NAD(P)H

    • Sensitivity: Moderate (lower detection limit ~5 nmol/min/mg protein)

  • Cytochrome c reduction assay:

    • Principle: Monitor quinone-mediated reduction of cytochrome c at 550 nm

    • Buffer: 50 mM Tris-HCl (pH 7.5), 0.1

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.