Recombinant Lolium perenne Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ycf4; LopeCp050; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
ycf4
Target Protein Sequence
MNWRSEHVWVELLKGSRKRGNFFWACILFLGSLGFLSVGASSYLGKNIISILPSQQILFF PQGVVMSFYGIAGLFISSYLWCTILWNVGSGYDRFDRKEGIVCIFRWGFPGIKRRVFLQF LMRDIQSIRIQVKEGLSPRRILYMEIRGQGVIPLTRTDEKFFTPREMEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function
Plays a crucial role in the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the ycf4 gene in Lolium perenne?

The ycf4 gene in Lolium perenne, as in other plants, is located in the Large Single Copy (LSC) region of the chloroplast genome. It exists within a local mutation hotspot that includes a characteristic gene cluster arrangement. Typically, the psaI and accD genes are found upstream of ycf4, while the cemA gene is located downstream . This genomic region is considered a mutation hotspot in the plastid genome and has undergone numerous rearrangements in different plant lineages, making it particularly interesting for evolutionary studies .

In Lolium perenne specifically, this gene cluster maintains the typical arrangement found in grasses, though the exact sequence characteristics may vary from other grass species. Understanding this genomic context is crucial for targeted genetic manipulation experiments, especially when developing chloroplast transformation vectors for ycf4 modification in perennial ryegrass.

How does Ycf4 protein contribute to photosystem I assembly in plants?

Ycf4 functions as a critical thylakoid protein essential for the assembly of photosystem I (PSI) complex. Based on studies in model organisms like Chlamydomonas reinhardtii, Ycf4 has been shown to form a stable, large complex (>1500 kD) that appears to act as a scaffold for PSI assembly .

Mechanistically, Ycf4 interacts with newly synthesized PSI polypeptides that are in the process of assembly into a pigment-containing subcomplex . This interaction facilitates the correct spatial organization of PSI components, which is critical for proper function. In Lolium perenne, as in other plants, Ycf4 likely performs this essential assembly role with species-specific characteristics that reflect evolutionary adaptations.

Key experimental evidence from knockout studies in tobacco demonstrates that complete removal of the YCF4 gene results in plants unable to grow autotrophically under normal conditions, highlighting the protein's essential nature for photosynthetic function . These plants exhibit a distinctive phenotype where newly emerged leaves are initially green but gradually bleach with maturity .

What is the structure of Ycf4 protein in Lolium perenne compared to other plant species?

The Ycf4 protein in Lolium perenne, like in most plants, is encoded by the plastid genome and typically consists of approximately 180-190 amino acids, though precise length can vary between species. While the search results don't provide the exact length for L. perenne Ycf4, we can extrapolate from related data.

Comparative analysis shows considerable variation in ycf4 gene length across plant species:

  • In tobacco (Nicotiana tabacum), YCF4 encodes 184 amino acids

  • In different IRLC legume tribes, it ranges from 564-567 bp in Astragalus to 630 bp in Trifolieae

  • In the Fabeae tribe, there is extensive length variation, with Vicia and Lens having 615 and 606 bp respectively

  • In Lathyrus species, length varies dramatically from 219 bp to 1023 bp

This variability suggests that while Ycf4's core function is conserved, structural adaptations have occurred throughout evolution, potentially reflecting species-specific optimizations of photosystem assembly processes. In recombinant protein production, these structural variations must be considered when designing expression constructs.

How has the ycf4 gene evolved in grasses compared to legumes, and what are the implications for Lolium perenne research?

The evolutionary trajectory of ycf4 shows marked differences between plant families. In IRLC legumes, especially within the Fabeae tribe, ycf4 exhibits extensive variation in both length and nucleotide substitution rates . For instance, the dN/dS ratio (a measure of selective pressure) reveals significantly accelerated evolution of ycf4 in certain genera, particularly Lathyrus, compared to other IRLC genera .

In contrast, based on comparative genomic studies, grasses like Lolium perenne typically show more conserved patterns of ycf4 evolution. While the search results don't provide specific data for L. perenne, grasses generally demonstrate lower rates of nucleotide substitution in plastid genes compared to the extreme variations seen in some legume lineages.

This evolutionary contrast has important implications for L. perenne research:

  • When designing recombinant Ycf4 production strategies, researchers can likely rely on more predictable protein characteristics than in highly variable species.

  • The relative conservation suggests functional constraints on Ycf4 in grasses, possibly indicating its essential role in photosystem I assembly is under stronger purifying selection in Poaceae.

  • Comparative studies between grass and legume Ycf4 could provide insights into the structural elements essential for PSI assembly versus those that are adaptable.

What evidence exists for positive selection on the ycf4 gene, and how might this affect functional studies of recombinant Ycf4?

Significant evidence for positive selection on the ycf4 gene has been documented, particularly in certain plant lineages. In the IRLC legumes, dN/dS analysis revealed that ycf4 has undergone positive selection, with acceleration of evolutionary rate particularly evident in the Fabeae tribe, especially within the genus Lathyrus . Branch-site model analysis identified seven specific codon sites in ycf4 that evolved under positive selective pressure specifically on the Lathyrus branch (codons encoding: 1L, 2S, 3V, 4V, 5L, 6L, 7T) .

This evidence of positive selection has several implications for functional studies of recombinant Ycf4 in Lolium perenne:

  • Amino acid residues under positive selection may represent functionally important sites that contribute to species-specific adaptations in photosystem assembly.

  • When producing recombinant Ycf4, researchers should consider whether conserved versus rapidly evolving regions might affect protein function differently when expressed in heterologous systems.

  • Comparative functional analysis between Ycf4 variants from species under different selective pressures (e.g., Lolium vs. Lathyrus) could reveal insights into structure-function relationships.

  • Mutagenesis studies focusing on sites identified under positive selection could help determine their contribution to protein function and photosystem assembly efficiency.

How do nonsynonymous and synonymous substitution rates in ycf4 compare with other plastid genes in Lolium perenne?

While the search results don't provide specific data for Lolium perenne, comparative analysis in other plant lineages reveals important patterns that can inform L. perenne research. In IRLC legumes, particularly Lathyrus species, ycf4 shows dramatically elevated rates of nucleotide substitution compared to other plastid genes like matK and rpl32 .

For example, between Lathyrus littoralis and L. japonicus, researchers found:

  • 67 nucleotide substitutions in ycf4

  • Only 4 nucleotide substitutions in matK

  • No differences in rpl32

This pattern suggests ycf4 evolves more rapidly than other plastid genes in some plant lineages. Based on patterns observed in other monocots, we can hypothesize that Lolium perenne likely shows more conservative evolutionary rates for ycf4 than seen in legumes, but still potentially higher than for highly conserved plastid genes.

The following comparative table illustrates typical substitution patterns observed in plastid genes across plant lineages:

GeneTypical LengthEvolutionary RateSelection PatternL. perenne Expected Pattern
ycf4550-630 bpVariablePositive in some lineagesModerate conservation
matK1512-1527 bpModerateMostly purifyingHighly conserved
rpl32153-183 bpLowStrong purifyingVery highly conserved

Understanding these comparative rates is essential when using ycf4 for phylogenetic analyses or designing experiments that rely on sequence conservation.

What are the optimal expression systems for producing recombinant Lolium perenne Ycf4 protein?

When producing recombinant L. perenne Ycf4 protein, several expression systems can be considered, each with distinct advantages depending on the research goals:

When designing expression constructs, consider that full-length versus truncated versions of Ycf4 may exhibit different interaction patterns, as demonstrated by in-silico protein-protein interaction studies showing that the C-terminal 91 amino acids of tobacco YCF4 maintain interactions with other chloroplast proteins .

What purification strategies are most effective for isolating recombinant Ycf4 while maintaining its native conformation?

Purifying recombinant Ycf4 while preserving its functional conformation requires specialized approaches due to its membrane association. Based on successful strategies for similar thylakoid proteins:

  • Affinity tag selection: Tandem affinity purification (TAP) tags have proven effective for Ycf4 isolation, as demonstrated in Chlamydomonas studies . Consider a combination of tags (His-tag plus a second affinity tag) to achieve higher purity.

  • Membrane solubilization: Optimize detergent selection through small-scale screening. Mild detergents like n-dodecyl β-D-maltoside (DDM) or digitonin often preserve membrane protein structure and function better than harsher detergents.

  • Multi-step purification protocol:

    • Initial membrane isolation via differential centrifugation

    • Detergent solubilization of membrane proteins

    • Affinity chromatography using the engineered tag

    • Size exclusion chromatography to separate the intact Ycf4 complex

For Lolium perenne Ycf4 specifically, consider that the purification protocol must account for the protein's tendency to form large complexes, as Chlamydomonas Ycf4 forms a complex >1500 kD . Sucrose gradient ultracentrifugation followed by ion exchange column chromatography has successfully purified intact Ycf4 complexes in their native state .

How can researchers verify the functionality of recombinant Ycf4 protein from Lolium perenne?

Verifying the functionality of recombinant L. perenne Ycf4 requires multiple complementary approaches:

  • Complementation assays: The gold standard for functionality testing is complementation of ycf4 knockout mutants. Using the tobacco ycf4 knockout system described in search result , researchers can transform these plants with the L. perenne ycf4 gene and assess restoration of autotrophic growth and normal photosynthetic function.

  • Protein-protein interaction analysis: Given Ycf4's role in PSI assembly, verifying interactions with PSI subunits is essential. Techniques include:

    • Co-immunoprecipitation with PSI subunits (PsaA, PsaB, PsaC, PsaD, PsaE, PsaF)

    • Split-GFP or FRET-based interaction assays

    • Yeast two-hybrid (for specific domain interactions)

  • Biophysical characterization: Compare structural properties of recombinant protein with native Ycf4:

    • Circular dichroism spectroscopy to assess secondary structure

    • Size exclusion chromatography to confirm complex formation

    • Electron microscopy to visualize complex architecture, as performed with Chlamydomonas Ycf4 complexes (measuring approximately 285 × 185 Å)

  • Functional PSI assembly assay: Pulse-chase protein labeling experiments similar to those performed with Chlamydomonas can detect association of newly synthesized PSI polypeptides with the Ycf4-containing complex, demonstrating scaffold function .

What molecular interactions does Ycf4 establish during photosystem I assembly in Lolium perenne?

The molecular interactions of Ycf4 during PSI assembly involve multiple protein partners and appear to be conserved across species, though with potential variations in interaction strength or specificity. Based on studies in model organisms and computational predictions, we can outline the key interactions likely occurring with L. perenne Ycf4:

  • Interactions with PSI core subunits: Ycf4 has been shown to interact with multiple PSI subunits including PsaA, PsaB, PsaC, PsaD, PsaE, and PsaF as demonstrated in Chlamydomonas . These interactions likely form the basis of its scaffold function during assembly.

  • Interactions with assembly partners: In Chlamydomonas, Ycf4 forms a complex with an opsin-related protein COP2 . While the exact counterpart in Lolium perenne is unknown, similar assembly factors likely exist.

  • Domain-specific interactions: Molecular docking studies of tobacco YCF4 indicate that different domains of the protein establish specific interactions. The C-terminal region (91 amino acids) particularly shows significant interaction capability with other chloroplast proteins , which explains why partial knockouts retaining this region maintain some functionality.

The in-silico protein-protein interaction analysis conducted for tobacco YCF4 provides a model for potential L. perenne Ycf4 interactions, with predicted partners including:

  • Photosystem components (psaA, psaB, psaC, psaH, psbA, psbB, psbC, psbD, psbE)

  • ATP synthase components (atpB, atpI)

  • Other photosynthetic proteins (rbcL, clpP, rpoA, rpoB, accD, petA)

  • Light-harvesting complex (LHC) proteins

How do mutations in different domains of Ycf4 affect its function in photosystem I assembly?

The functional impact of mutations in different Ycf4 domains reveals important structure-function relationships that inform recombinant protein design. Key findings from the literature provide insights applicable to L. perenne Ycf4:

  • N-terminal vs. C-terminal domain functions: Studies comparing complete versus partial YCF4 knockouts in tobacco revealed critical functional differences. While removal of the entire YCF4 gene resulted in plants unable to grow autotrophically, knockout of just the N-terminal 93 amino acids (leaving the C-terminal 91 amino acids intact) produced plants that could still grow autotrophically . This demonstrates that the C-terminal domain retains sufficient interaction capability to support minimal PSI assembly.

  • Regions under positive selection: In IRLC legumes, particularly Lathyrus, seven specific codon sites in ycf4 were identified under positive selection (1L, 2S, 3V, 4V, 5L, 6L, 7T) . These sites may represent functionally important residues that contribute to lineage-specific adaptations in photosystem assembly mechanisms.

The phenotypic consequences of Ycf4 mutations are dramatic. Complete YCF4 knockout tobacco plants show a distinctive pattern where:

  • Newly emerged young leaves are initially green

  • Leaves gradually bleach as they mature

  • Lowermost leaves become almost white with minimal chlorophyll

  • Plants exhibit stunted growth and cannot grow autotrophically

These findings suggest that when designing recombinant L. perenne Ycf4 variants, preserving the C-terminal domain is critical for maintaining basic functionality, while mutations in positively selected sites might produce more subtle effects on assembly efficiency or environmental adaptation.

What methods can determine the stoichiometry and assembly kinetics of recombinant Ycf4 in PSI formation?

Determining the stoichiometry and assembly kinetics of recombinant Ycf4 during PSI formation requires sophisticated biophysical and biochemical approaches:

  • Quantitative mass spectrometry: Absolute quantification methods such as:

    • Selected reaction monitoring (SRM)

    • Parallel reaction monitoring (PRM)

    • Stable isotope labeling with amino acids in cell culture (SILAC)

    These techniques can determine the molar ratio of Ycf4 to PSI subunits in purified complexes.

  • Pulse-chase experiments: As successfully applied with Chlamydomonas Ycf4 , pulse-chase protein labeling can reveal:

    • The temporal sequence of PSI subunit association with Ycf4

    • Residence time of different subunits in the assembly complex

    • Rate of transition from assembly complex to mature PSI

  • Single-molecule fluorescence approaches:

    • Fluorescence correlation spectroscopy (FCS) to determine complex size and diffusion properties

    • Single-molecule FRET to monitor assembly events in real-time

    • Total internal reflection fluorescence (TIRF) microscopy to visualize assembly complexes

  • Cryo-electron microscopy: To visualize the architecture of assembly intermediates and determine the positioning of Ycf4 within these complexes.

For L. perenne specifically, these methods would need to be adapted to account for potential species-specific assembly characteristics. The finding that Chlamydomonas Ycf4 complexes form large structures measuring 285 × 185 Å provides a reference point for expected complex dimensions.

How does Lolium perenne Ycf4 compare functionally with Ycf4 from model organisms like Chlamydomonas and tobacco?

Functional comparison between L. perenne Ycf4 and its counterparts in model organisms reveals important insights into conservation and specialization of this protein:

  • Functional conservation: The fundamental role of Ycf4 as a PSI assembly factor appears conserved across photosynthetic organisms. In both Chlamydomonas and tobacco, Ycf4 is essential for PSI accumulation and autotrophic growth . Based on the conservation of photosynthetic machinery across plant lineages, L. perenne Ycf4 likely shares this core function.

  • Structural organization differences:

    • In Chlamydomonas, Ycf4 forms a >1500 kD complex containing the opsin-related COP2 protein and PSI subunits

    • In tobacco, YCF4 forms complexes with other chloroplast proteins, with particular importance of the C-terminal region

    • The specific complex composition in L. perenne remains to be determined, but likely combines elements of both models

  • Knockout phenotypes: Complete knockout of tobacco YCF4 prevents autotrophic growth , while in Chlamydomonas, Ycf4 is similarly essential for PSI accumulation . This suggests L. perenne would show similar dependence on Ycf4 for photosynthetic function.

  • Response to environmental conditions: Tobacco YCF4 knockout plants show sensitivity to light conditions, with different phenotypes under normal versus low light . This suggests Ycf4's function may be modulated by environmental factors, a characteristic likely shared by L. perenne Ycf4 given the adaptation of this grass to diverse environments.

What structural features distinguish grass Ycf4 proteins from those of other plant lineages?

The structural features distinguishing grass Ycf4 proteins from those of other plant lineages provide important context for recombinant protein design and functional analysis:

  • Sequence conservation patterns: While the search results don't provide specific sequence comparisons for Lolium perenne, general patterns in plastid gene evolution suggest grasses maintain more conserved Ycf4 sequences compared to the extreme variability seen in some legume lineages like Lathyrus .

  • Length variations: Ycf4 shows remarkable length variation across plant lineages:

    • In IRLC legumes: 564-567 bp in Astragalus and Oxytropis to 630 bp in Trifolieae

    • In Fabeae: 615 bp in Vicia, 606 bp in Lens

    • In Lathyrus species: extreme variation from 219 bp to 1023 bp

    • In tobacco: 552 bp (184 amino acids)

    Grass Ycf4 proteins, including L. perenne, typically show more moderate length and less extreme variation than seen in legumes.

  • Domain conservation: The C-terminal region of Ycf4 appears functionally significant across species, as demonstrated by the partial functionality retained when only this domain is present in tobacco . This suggests structural conservation of key functional domains across plant lineages including grasses.

  • Codon selection patterns: While certain legume lineages show positive selection in specific codons , grass Ycf4 likely experiences different selection pressures reflecting their ecological adaptations and photosynthetic requirements.

How can inter-species functional complementation experiments inform our understanding of Ycf4 evolution and specialization?

Inter-species functional complementation experiments provide powerful insights into the evolution and specialization of Ycf4 across plant lineages, with important implications for L. perenne research:

  • Complementation experimental design:

    • Transform ycf4 knockout lines (such as the tobacco system described in result ) with L. perenne ycf4

    • Assess restoration of phenotype (autotrophic growth, chlorophyll content, PSI assembly)

    • Compare complementation efficiency with ycf4 genes from other species

    • Test chimeric proteins combining domains from different species to map functional regions

  • Evolutionary implications: Results from such experiments can reveal:

    • The degree of functional conservation versus specialization across lineages

    • Whether positive selection has produced species-specific functional adaptations

    • If co-evolution with interaction partners constrains inter-species compatibility

  • Methodological approach:

    Experimental ComponentDetails
    Recipient systemHomoplasmic Δycf4 tobacco plants
    Transformation methodParticle bombardment of tobacco leaves
    Selection markerSpectinomycin resistance via aadA gene
    Phenotypic assessmentGrowth on media with varying sucrose concentrations (0-3%)
    Molecular verificationPCR, immunoblotting, RNA analysis
    Functional assaysChlorophyll fluorescence, PSI content quantification
  • Predictive hypotheses: Based on evolutionary patterns, we might predict:

    • L. perenne Ycf4 would likely complement tobacco ycf4 knockouts, but perhaps with reduced efficiency

    • Complementation success would correlate with evolutionary distance

    • The C-terminal domain would show greater functional conservation than the N-terminal region

Such inter-species complementation studies would not only reveal the functional plasticity of Ycf4 but also provide insights into the co-evolution of chloroplast genes and their products in the context of photosynthetic adaptation.

What are the most promising future research directions for Lolium perenne Ycf4 studies?

Based on the current state of knowledge, several promising research directions emerge for Lolium perenne Ycf4 studies:

  • Structural biology approaches: Determining the high-resolution structure of L. perenne Ycf4 and its assembly complexes would dramatically advance our understanding of PSI assembly mechanisms. Cryo-electron microscopy of purified complexes, as pioneered with Chlamydomonas Ycf4 , represents a particularly promising approach.

  • Functional genomics in L. perenne: Developing chloroplast transformation systems specifically for L. perenne would enable direct manipulation of ycf4 in its native context. The established tobacco system provides a methodological framework that could be adapted for perennial ryegrass.

  • Environmental adaptation studies: Investigating how Ycf4 function varies under different environmental conditions relevant to L. perenne ecology (temperature, light intensity, drought) could reveal specialized adaptations of PSI assembly in this economically important grass species.

  • Comparative genomics: Expanding evolutionary analyses of ycf4 across the Poaceae family could reveal grass-specific patterns of selection and adaptation, contextualizing the L. perenne protein within its phylogenetic background.

  • Synthetic biology applications: Engineering optimized versions of L. perenne Ycf4 could potentially enhance photosynthetic efficiency, with applications in both basic research and agricultural improvement.

These research directions collectively would advance both fundamental understanding of photosynthetic assembly mechanisms and potential applications in grass improvement programs.

What are the critical methodological considerations for researchers working with recombinant Lolium perenne Ycf4?

Researchers working with recombinant L. perenne Ycf4 should consider several critical methodological factors:

  • Expression system selection: The membrane-associated nature of Ycf4 presents challenges for heterologous expression. Consider:

    • Plant-based expression systems for authentic post-translational modifications

    • Specialized E. coli strains designed for membrane protein expression

    • Fusion tags that enhance solubility while minimizing functional interference

  • Protein purification optimization:

    • Detergent screening is essential for maintaining native conformation

    • Tandem affinity purification approaches have proven successful for Ycf4

    • Consider native PAGE rather than SDS-PAGE for complex integrity verification

  • Functional verification strategies:

    • Complementation of ycf4 knockout mutants remains the gold standard

    • In vitro reconstitution assays can assess assembly scaffold function

    • Protein-protein interaction studies must account for membrane environment

  • Sequence considerations:

    • Include both coding sequence and relevant regulatory elements

    • Consider codon optimization for the expression host

    • Create truncation constructs to map functional domains, informed by the finding that the C-terminal region retains interactions with chloroplast proteins

  • Experimental controls:

    • Include wild-type Ycf4 from model organisms as positive controls

    • Non-functional Ycf4 mutants as negative controls

    • Consider evolutionary distance when interpreting cross-species functionality

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.