Recombinant Lolium perenne Photosystem II CP47 chlorophyll apoprotein (psbB)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Role

The psbB gene encodes the CP47 protein, a core antenna chlorophyll-binding subunit of PSII. CP47 binds 16 chlorophyll a molecules and 4 β-carotenes, forming part of the inner light-harvesting antenna system . In L. perenne, as in other plants, CP47 interacts with PSII reaction center components (D1/D2) and oxygen-evolving enhancer (OEE) proteins to facilitate light-driven water oxidation .

Key Functions of CP47:

FunctionDescription
Light HarvestingTransfers excitation energy to the PSII reaction center .
Structural SupportAnchors the OEE proteins and stabilizes the PSII core complex .
Chlorophyll BindingDirectly ligates chlorophyll molecules via histidine residues .

Assembly and Biogenesis

CP47 integrates into PSII during early assembly stages, forming intermediates like RC47 (reaction center complex with CP47) . In cyanobacteria, Psb28 and PsbH subunits stabilize CP47 during synthesis and repair . Defects in these chaperones disrupt chlorophyll biosynthesis and PSII assembly .

Key Assembly Intermediates:

ComplexCompositionFunction
RC47D1, D2, CP47, PsbL, PsbTEarly PSII core assembly .
CP47-HisCP47, PsbH, PsbL, PsbTPreassembled pigment-protein complex .

Chlorophyll Binding and Spectroscopy

CP47 binds chlorophyll a via histidine residues (e.g., positions 5, 16, 23, 29, and 34 in spinach) . Recombinant CP47-His from Synechocystis shows absorption peaks at ~435 nm (Soret) and ~675 nm (Qy) . Fluorescence quantum yields are lower than native PSII, suggesting incomplete pigment organization in recombinant forms .

Recombinant Production Challenges

Recombinant psbB faces challenges in maintaining native pigment binding and structure. In E. coli, CP47 is often expressed without chlorophyll due to the lack of plastid-derived pigments . Refolding protocols or co-expression with chlorophyll biosynthetic enzymes may be required for functional studies.

Common Purification Methods:

  1. His-tag affinity chromatography: Used for L. sativa and S. oleracea CP47 .

  2. Size-exclusion chromatography: Resolves monomeric vs. dimeric forms .

Relevance to Lolium perenne

While no direct studies on L. perenne’s recombinant psbB exist, the species is a model for photosynthetic research. For example:

  • Proteomic studies have identified antioxidant enzymes (e.g., superoxide dismutase, peroxiredoxin) in L. perenne green juice, highlighting its potential for biorefining .

  • Genetic transformation protocols for L. perenne protoplasts enable future psbB engineering .

Future Directions

  1. CRISPR-Cas9 Editing: Target psbB to study PSII repair mechanisms.

  2. Co-expression Systems: Produce recombinant CP47 with chlorophyll in E. coli or algal hosts.

  3. Structural Studies: Resolve L. perenne CP47 via cryo-EM or X-ray crystallography.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us for preferential development.
Synonyms
psbB; LopeCp067; Photosystem II CP47 reaction center protein; PSII 47 kDa protein; Protein CP-47
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-508
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
psbB
Target Protein Sequence
MGLPWYRVHTVVLNDPGRLLAVHIMHTALVSGWAGSMALYELAVFDPSDPVLDPMWRQGM FVIPFMTRLGITDSWGGWSISGGTVTNPGIWSYEGVAGAHIVFSGLCFLAAIWHWVYWDL AIFSDDRTGKPSLDLPKIFGIHLFLAGVACFGFGAFHVTGLYGPGIWVSDPYGLTGKVQA VNPAWGAEGFDPFVPGGIASHHIAAGTLGILAGLFHLSVRPPQRLYKGLRMGNIETVLSS SIAAVFFAAFVVAGTMWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSE AWSKIPEKLAFYDYIGNNPAKGGLFRAGSMDNGDGIAVGWLGHPVFRDKEGRELFVRRMP TFFETFPVVLVDEEGIVRADVPFRRAESKYSVEQVGVTVEFYGGELNGVSYSDPATVKKY ARRSQLGEIFELDRATLKSDGVFRSSPRGWFTFGHATFALLFFFGHIWHGARTLFRDVFA GIDPDLDAQVEFGTFQKVGDPTTRKQAV
Uniprot No.

Target Background

Function

A core component of the Photosystem II (PSII) complex. It binds chlorophyll and facilitates the primary light-driven photochemical reactions of PSII. PSII is a light-driven water:plastoquinone oxidoreductase; it utilizes light energy to extract electrons from H₂O, producing O₂ and a proton gradient for subsequent ATP synthesis.

Protein Families
PsbB/PsbC family, PsbB subfamily
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the role of CP47 chlorophyll apoprotein (psbB) in Photosystem II?

The CP47 protein serves as a core antenna component of Photosystem II (PSII) and is indispensable for the assembly of functional PSII complexes. It is a chlorophyll-binding protein encoded by the psbB gene that facilitates light harvesting and energy transfer to the reaction center of PSII. The accumulation of chlorophyll and expression of CP47 are essential prerequisites for the proper assembly and function of the entire PSII complex .

How is the psbB gene regulated in Lolium perenne?

The psbB gene in Lolium perenne, like in other plants, is regulated primarily by light-dependent mechanisms. Analysis of photosynthetic promoters in perennial ryegrass has revealed several important cis-regulatory elements that control psbB expression. These include the I-Box motif, GT1 box, and monocot RbcS consensus sequences, which are common in light-regulated genes in higher plants .

Research has shown that psbB expression is coordinated with chlorophyll biosynthesis, and both processes are essential for PSII assembly. The gene is predominantly expressed in photosynthetic tissues, as confirmed by in silico expression analysis of EST sequences from various tissue libraries. Understanding this regulatory network is crucial for researchers attempting to manipulate psbB expression for enhanced photosynthetic efficiency .

What methods are available for detecting recombinant psbB expression in transformed plants?

Several complementary approaches can be used to confirm and quantify recombinant psbB expression:

  • Real-time PCR: This technique allows for the detection and quantification of transgene integration and expression, comparing results with positive controls (plasmid DNA) and negative controls (non-transgenic plant DNA) .

  • Southern hybridization: This method uses genomic DNA with chemiluminescent detection to visualize the results of probes designed for the psbB gene and confirm successful transformation .

  • Western blot analysis: Using specific antibodies such as the polyclonal antibody AS04 038, researchers can detect the CP47 protein. The recommended dilution for Western blot applications is 1:2000, with an expected molecular weight of approximately 56 kDa .

  • Clear-native PAGE (CN-PAGE): This technique can be used to analyze protein complexes containing CP47 while maintaining their native state, with a recommended antibody dilution of 1:10,000 .

When conducting these analyses, it is advisable to include appropriate controls and standardize protocols to ensure reliable and reproducible results.

What is the relationship between chlorophyll biosynthesis and CP47 protein accumulation?

There is a direct relationship between chlorophyll biosynthesis and CP47 protein accumulation, as demonstrated by studies on CP47 mutants. Research has shown that increased availability of chlorophyll precursors enhances the synthesis and stability of the CP47 protein .

In studies with Synechocystis, it was observed that complementing mutations that decrease ferrochelatase activity led to increased steady-state levels of chlorophyll precursors and chlorophyll itself. This increase was followed by enhanced CP47 accumulation and improved PSII assembly. Similarly, supplementation with the chlorophyll precursor Mg-protoporphyrin IX increased the number of active PSII centers, suggesting that synthesis of CP47 protein is enhanced by increased chlorophyll availability in the cell .

This relationship indicates that coordinated manipulation of both chlorophyll biosynthesis and psbB expression may be necessary for optimizing PSII assembly and function in recombinant systems.

What strategies can be employed for tissue-specific expression of recombinant psbB in Lolium perenne?

For tissue-specific expression of recombinant psbB in Lolium perenne, researchers can utilize photosynthetic tissue-specific promoters. Based on research with similar photosynthetic genes, the following strategies have proven effective:

  • Photosynthetic promoters: The RbcS (Rubisco small subunit) and CAB (Chlorophyll a/b Binding Protein) promoters show strong, tissue-specific expression in photosynthetic tissues. In perennial ryegrass, LpRbcS and LpCAB genes have been characterized and their promoters isolated for driving transgene expression .

  • Promoter regulatory elements: Specific cis-acting regulatory sequences should be incorporated into expression constructs to ensure proper light-responsive expression. Key elements include:

cis-Acting Regulatory SequenceAccessionPosition in LpRbcSPosition in LpCAB
I-Box CoreS000199-184-137
I-BoxS000124-311-137
GT1 consensusS000198-304n.p.
RbcS monocot seq--173 to -151n.p.
SORLIPsS000482n.p.-58, -217, -647, -695
  • Vector design: For optimal tissue-specific expression, backbone-free expression cassettes should be constructed using gateway recombination technology with the isolated perennial ryegrass-specific promoters driving the psbB gene, followed by appropriate termination signals .

When implementing these strategies, it is essential to use a tissue culture-responsive genotype for transformation and to confirm the expression pattern using the methods outlined in question 1.3.

How can researchers address the challenges of co-expression of psbB with other photosynthetic proteins?

Coordinated expression of psbB with other photosynthetic proteins presents several challenges that can be addressed through the following approaches:

  • Translational fusion strategy: Similar to the approach used for fructosyltransferases in perennial ryegrass, researchers can create genetic fusions between psbB and other proteins of interest. This strategy facilitates the physical association of proteins that may interact functionally, potentially enhancing the efficiency of complex assembly .

  • Polycistronic expression systems: Multiple genes can be expressed from a single transcript using internal ribosome entry sites (IRES) or 2A peptide sequences, ensuring stoichiometric production of interacting proteins.

  • Optimization of chlorophyll availability: Since CP47 protein accumulation is dependent on chlorophyll availability, strategies that enhance chlorophyll biosynthesis should be implemented concurrently. This could involve manipulating enzymes in the chlorophyll biosynthetic pathway, such as ferrochelatase, whose decreased activity has been shown to improve CP47 accumulation and PSII assembly .

  • Selection of appropriate promoters: Using promoters with similar expression patterns and strengths for all co-expressed genes can help maintain appropriate ratios of interacting proteins. The identified photosynthetic promoters from perennial ryegrass (LpRbcS and LpCAB) provide excellent candidates for coordinated expression .

Researchers should also implement quality control measures, such as analyzing protein complex formation using clear-native PAGE combined with Western blotting using antibodies specific to each protein component .

What methodological approaches can be used to study the impact of psbB mutations on PSII assembly in Lolium perenne?

To study the impact of psbB mutations on PSII assembly in Lolium perenne, researchers can employ a multi-faceted approach:

  • CRISPR/Cas9 gene editing: Generate specific mutations in the psbB gene, targeting conserved domains important for chlorophyll binding or protein-protein interactions. This approach allows for precise modification of the endogenous gene.

  • Transgenic expression of mutated psbB variants: Create various mutated versions of psbB and express them in wild-type or psbB-deficient backgrounds to study dominant-negative effects or complementation.

  • Phenotypic and functional analyses:

    • Measure photosynthetic parameters (oxygen evolution, fluorescence induction, P700 redox kinetics)

    • Analyze growth under different light intensities and spectral qualities

    • Assess stress tolerance (high light, temperature extremes, drought)

  • Biochemical and structural analyses:

    • Isolate thylakoid membranes and analyze protein complexes using clear-native PAGE

    • Perform Western blotting with the CP47-specific antibody (AS04 038) to quantify protein accumulation

    • Use immunoprecipitation to study protein-protein interactions within PSII

    • Analyze chlorophyll binding using spectroscopic methods

  • Complementation studies with chlorophyll precursors: Supplement plants with chlorophyll precursors like Mg-protoporphyrin IX to determine if phenotypes can be rescued, similar to studies in Synechocystis .

This comprehensive approach will provide insights into structure-function relationships of CP47 and its role in PSII assembly in perennial ryegrass.

What are the most effective transformation methods for introducing recombinant psbB into Lolium perenne?

For introducing recombinant psbB into Lolium perenne, several transformation methods have been evaluated, with biolistic transformation showing the highest efficiency. The following methodology is recommended based on successful transformation protocols for perennial ryegrass:

  • Biolistic transformation protocol:

    • Select a tissue culture-responsive genotype (such as FLp418-20) based on shoot regeneration capacity from embryogenic callus

    • Create clonal replicates to provide material for transformation

    • Design vectors without backbone sequences for optimal expression and minimal silencing

    • Include appropriate selectable markers separate from the expression cassette

    • Use the biolistic method as described by Spangenberg et al.

  • Vector design considerations:

    • Utilize perennial ryegrass-specific promoters (LpRbcS or LpCAB) for photosynthetic tissue-specific expression

    • Include appropriate termination signals (e.g., TaRbcS terminator)

    • Consider using Gateway recombination technology for efficient cloning

    • Remove vector backbone sequences to reduce silencing effects

  • Post-transformation selection and regeneration:

    • Culture transformed tissue on selective media

    • Confirm transgene integration using real-time PCR with appropriate controls

    • Verify transgene copy number using Southern hybridization

    • Regenerate whole plants through tissue culture protocols specific for perennial ryegrass

This approach has been successfully implemented for the transformation of perennial ryegrass with other photosynthetic genes and can be adapted for psbB transformation with high efficiency.

How can researchers investigate the interaction between recombinant psbB expression and environmental stress responses?

Investigating the interaction between recombinant psbB expression and environmental stress responses requires a multi-layered experimental approach:

  • Controlled environment studies:

    • Create transgenic lines with psbB under both constitutive and inducible promoters

    • Expose plants to defined stress conditions (drought, temperature extremes, high light, nutrient limitation)

    • Monitor photosynthetic parameters (quantum yield, electron transport rate, non-photochemical quenching)

    • Compare physiological responses between wild-type and transgenic lines

  • Molecular analysis of stress responses:

    • Perform RNA-seq to identify differentially expressed genes under stress conditions

    • Use quantitative RT-PCR to validate expression changes in stress-responsive genes

    • Analyze post-translational modifications of CP47 under stress using proteomic approaches

    • Investigate protein-protein interactions that may be altered under stress conditions

  • Biochemical and structural analyses:

    • Monitor changes in PSII assembly and stability under stress using clear-native PAGE

    • Track CP47 turnover rates under stress using pulse-chase experiments

    • Analyze reactive oxygen species production and antioxidant responses

    • Assess chlorophyll biosynthesis and degradation pathways under stress

  • Field trials with environmental monitoring:

    • Evaluate performance of transgenic lines under natural environmental fluctuations

    • Continuously monitor environmental parameters alongside plant physiological responses

    • Assess seasonal variations in photosynthetic efficiency and stress tolerance

This comprehensive approach will provide insights into how recombinant psbB expression affects the plant's ability to maintain photosynthetic efficiency under stress, potentially leading to the development of more resilient varieties for changing environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.