Recombinant Lolium perenne Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lolium perenne Photosystem Q(B) Protein

Recombinant Lolium perenne Photosystem Q(B) protein is a genetically engineered version of the Photosystem Q(B) protein found in Lolium perenne, commonly known as perennial ryegrass. This protein is part of the Photosystem II (PSII) complex, which plays a crucial role in photosynthesis by facilitating the transfer of electrons and protons across the thylakoid membrane in chloroplasts. The recombinant form of this protein is produced through genetic engineering techniques, allowing for its expression in various host organisms for research or biotechnological applications.

Role of Photosystem Q(B) Protein in Photosynthesis

Photosystem Q(B) protein, also known as the D1 protein's binding partner, is essential for the proper functioning of PSII. It binds to plastoquinone, which acts as an electron acceptor in the electron transport chain. This process helps in generating ATP and NADPH, crucial energy carriers in photosynthesis.

Recombinant Production and Applications

The recombinant production of Lolium perenne Photosystem Q(B) protein involves cloning the gene encoding this protein into an expression vector, which is then introduced into a host organism such as bacteria or yeast. This allows for large-scale production of the protein for various applications, including:

  • Research: Studying the structure and function of PSII and its components.

  • Biotechnology: Developing more efficient photosynthetic systems or improving crop yields.

  • Diagnostics: Using the protein as an antigen for producing antibodies to detect PSII-related proteins in plant samples.

Table 1: Comparison of PSII Proteins Across Different Organisms

Protein/FunctionArabidopsis (LQY1)Lolium perenne (Photosystem Q(B))
FunctionInvolved in PSII repair and assemblyEssential for electron transport in PSII
LocationThylakoid membraneThylakoid membrane
Stress ResponseProtects against high light stressNot specified

References

- Frontiers in Plant Science: Identification and Roles of Photosystem II Assembly, Stability, and Repair Proteins.
- ELISA Recombinant Lolium perenne Photosystem Q(B) protein.
- Identifying Endogenous Proteins of Perennial Ryegrass (Lolium perenne).

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing your order. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be decided during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
psbA; LopeCp001; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Lolium perenne (Perennial ryegrass)
Target Names
psbA
Target Protein Sequence
MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function
Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase that harnesses light energy to extract electrons from H2O. This process generates O2 and a proton gradient, which is subsequently utilized for ATP formation. PSII comprises a core antenna complex responsible for capturing photons and an electron transfer chain that converts photonic excitation into charge separation. The D1/D2 (PsbA/PsbA) reaction center heterodimer binds P680, the primary electron donor of PSII, along with several subsequent electron acceptors.
Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is Photosystem Q (B) protein and its role in Lolium perenne photosynthesis?

The Photosystem Q (B) protein functions as a critical electron acceptor within Photosystem II of L. perenne, facilitating electron transport from QA to the plastoquinone pool. Methodologically, researchers identify this protein through comparative genomics against model organisms and using biophysical characterization techniques including spectroscopy and mass spectrometry.

The protein's functionality is especially sensitive to light quality and intensity, with research showing differential photosynthetic rates under various spectral compositions. Under cool white light at 400 μmol m⁻² s⁻¹, L. perenne exhibits maximum photosynthetic efficiency with higher foliar pigment concentrations and increased soluble sugar accumulation compared to lower light intensities .

How do different light spectra affect expression and function of Photosystem components in L. perenne?

Experimental evidence demonstrates that L. perenne photosynthetic performance varies significantly under different spectral compositions. The methodological approach to studying these effects involves growing plants under controlled LED lighting with precise spectral parameters:

Light TreatmentPhotosynthetic PerformanceChlorophyll ContentEnergy Efficiency
Cool White (W)HighestHighBaseline (100%)
R80:B20Intermediate-HighHigh75.7% of W
R65:G15:B20Intermediate-HighHighNot specified
R90:B10LowestLowerNot specified

Blue light significantly influences stomatal conductance, with at least 20% blue light recommended for optimal photosynthetic performance. The presence of sufficient blue light (20%) enhances chlorophyll and carotenoid biosynthesis compared to lower blue light percentages (10%) . This has direct implications for the function of Photosystem II components including the Q (B) binding site.

What expression systems are most effective for producing functional recombinant Photosystem proteins from L. perenne?

The methodological approach to expressing functional recombinant Photosystem proteins from L. perenne requires careful consideration of several factors:

  • Host selection: Chloroplast-containing organisms (cyanobacteria, algae) maintain the native-like environment required for proper folding and cofactor incorporation

  • Vector design: Inclusion of L. perenne-specific regulatory elements and appropriate targeting sequences

  • Optimization protocols: Temperature gradient experiments (15-25°C optimal range for L. perenne proteins)

  • Solubilization strategies: Detergent screening (typically β-DDM or digitonin) for membrane-integrated components

  • Functional validation: Oxygen evolution measurements and electron transfer kinetics assays

Recent advances in CRISPR/Cas9 implementation in ryegrass provide new opportunities for developing modified expression systems with enhanced production capabilities .

How does RNA editing affect the expression and function of Photosystem proteins in L. perenne?

RNA editing in chloroplast transcripts of L. perenne potentially affects the coding sequence of photosynthetic proteins, including Photosystem components. The methodological approach to investigating this phenomenon involves:

  • Comparison of genomic DNA and cDNA sequences to identify C-to-U or U-to-C conversion sites

  • Quantification of editing efficiency using trace-file methods compared to conventional colony screening

  • Assessment of editing pattern differences between cultivars (e.g., 'Cashel' and 'New Zealand')

  • Evaluation of stress effects on editing patterns (particularly drought stress)

Researchers must consider RNA editing when designing recombinant expression constructs, as the genomic sequence may require synthetic editing to match the mature transcript sequence for proper protein function. Studies suggest editing efficiency varies among transcripts and may be affected by environmental conditions .

What structural adaptations of the Photosystem Q (B) protein facilitate L. perenne's performance under variable light conditions?

The methodological approach to investigating structural adaptations includes:

  • Comparative sequence analysis across multiple L. perenne cultivars

  • Homology modeling based on crystallographic data

  • Site-directed mutagenesis of key residues in the QB binding pocket

  • Functional studies under varying light intensities and spectral qualities

Research indicates that L. perenne has evolved specific structural adaptations in the QB binding site that contribute to its notable photosynthetic plasticity. Cultivars show varied responses to different light treatments, particularly in their ability to utilize blue light components effectively. Light with 80% Red:20% Blue (R80:B20) represents a good compromise between physiological performance and energy consumption, allowing energy savings of 24.3% compared to white light while maintaining adequate photosynthetic function .

How do drought stress conditions affect Photosystem Q (B) protein turnover in L. perenne?

Drought stress significantly impacts D1/Photosystem Q (B) protein turnover rates in L. perenne. The methodological approach to investigating this relationship includes:

  • PEG-induced drought simulation under controlled conditions

  • Pulse-chase labeling to quantify protein synthesis and degradation rates

  • Western blot analysis with specific antibodies to monitor protein levels

  • Chlorophyll fluorescence measurements to correlate protein turnover with photosynthetic efficiency

Experimental evidence indicates that water deficit conditions alter RNA editing patterns , which may affect translation efficiency and protein structure of photosynthetic components. Additionally, stress conditions typically accelerate D1 protein damage, necessitating increased repair cycle activity, which may become compromised under prolonged drought.

What molecular interactions between the Photosystem Q (B) protein and LRX/RALF proteins might influence photosynthetic efficiency?

Recent research has identified leucine-rich repeat extensin (LRX) proteins and rapid alkalinization factors (RALF) as important regulators of calcium-dependent signaling in plants. The methodological approach to investigating potential interactions with photosynthetic components includes:

  • Co-immunoprecipitation assays to detect physical interactions

  • Bimolecular fluorescence complementation to visualize interactions in vivo

  • Calcium imaging to monitor signaling responses

  • Functional assays to measure electron transport under varying calcium conditions

LRX proteins participate in transducing extracellular signals from the cell wall to the cytoplasm, while RALF proteins induce alkalinization of extracellular space by increasing cytoplasmic Ca²⁺ concentration . Since calcium gradients are critical for both pollen tube growth and photosynthetic regulation, crosstalk between these signaling systems may represent an unexplored aspect of photosynthetic regulation in L. perenne.

What genomic regions co-segregate with photosynthetic efficiency traits in L. perenne breeding populations?

Quantitative trait locus (QTL) mapping approaches have been successfully applied to identify genomic regions associated with various traits in L. perenne. The methodological approach to mapping photosynthetic efficiency traits includes:

  • Development of mapping populations (F₂, backcross, or recombinant inbred lines)

  • Genotyping using markers like SNPs derived from genotyping-by-sequencing

  • Phenotyping for photosynthetic parameters (gas exchange, chlorophyll fluorescence)

  • QTL analysis to identify significant marker-trait associations

Similar techniques have successfully identified a major QTL for self-compatibility on linkage group 5 in L. perenne, explaining 38.4% of phenotypic variance . The genetic architecture underlying photosynthetic efficiency likely involves multiple loci with varying effect sizes, potentially interacting with loci controlling other physiological processes.

What protocols ensure optimal isolation of functional Photosystem complexes from L. perenne?

The methodological approach to isolating intact, functional Photosystem complexes from L. perenne requires:

  • Tissue preparation: Young leaves harvested pre-dawn to minimize photodamage

  • Homogenization buffer: 50 mM HEPES-KOH (pH 7.5), 330 mM sorbitol, 2 mM EDTA, 1 mM MgCl₂, 5 mM ascorbate, 0.05% BSA

  • Differential centrifugation: Initial 300×g to remove debris, followed by 1,500×g to pellet chloroplasts

  • Osmotic shock: Resuspension in 10 mM HEPES-KOH (pH 7.5), 5 mM MgCl₂ to release thylakoid membranes

  • Solubilization: 1% β-DDM or 1% digitonin at a chlorophyll concentration of 1 mg/ml

  • Purification: Sucrose density gradient ultracentrifugation or ion exchange chromatography

This process must be conducted under dim green light to minimize photodamage, with all solutions maintained at 4°C and supplemented with protease inhibitors.

How can researchers effectively assess functional differences between wild-type and recombinant Photosystem Q (B) protein variants?

The comprehensive assessment methodology includes:

  • Oxygen evolution measurements: Clark-type electrode measurements under saturating light conditions

  • Electron transfer kinetics: Flash-induced chlorophyll fluorescence decay kinetics to measure QA⁻ to QB electron transfer rates

  • Thermoluminescence: Characterizing charge recombination events specific to the QB site

  • Herbicide binding assays: Competitive binding studies with DCMU and other QB-site inhibitors

  • Site-directed mutagenesis: Systematic modification of key residues to establish structure-function relationships

By combining these approaches, researchers can develop a comprehensive understanding of functional differences between protein variants. Experimental design should consider that light quality significantly affects photosynthetic performance in L. perenne, with cool white light generally contributing to better performance than red-blue combinations with insufficient blue light percentage .

How might advances in synthetic biology facilitate the production of optimized Photosystem components for enhanced photosynthetic efficiency?

The methodological pathway toward creating optimized Photosystem components involves:

  • Computational protein design: In silico modeling of modified Q (B) binding sites with altered redox properties

  • DNA synthesis technologies: Creating synthetic genes with codon optimization for L. perenne

  • Assembly techniques: Golden Gate or Gibson Assembly for modular construction of modified photosystems

  • CRISPR/Cas9 implementation: Precise genome editing to introduce optimized components into the chloroplast genome

  • High-throughput phenotyping: Automated systems to screen large numbers of variants

Recent advances in genome editing through CRISPR/Cas9 and its implementation in ryegrass make this a particularly promising approach for future studies of Photosystem proteins . The ability to make targeted genetic modifications in L. perenne opens new avenues for improving photosynthetic efficiency.

What strategies can overcome the challenges of expressing membrane-integral Photosystem components in heterologous systems?

The methodological challenges of heterologous expression of membrane proteins like the Photosystem Q (B) protein require specific strategies:

  • Specialized expression hosts: Developing L. perenne chloroplast-derived expression systems

  • Membrane mimetics: Utilizing nanodiscs, liposomes, or amphipols to provide native-like environments

  • Fusion tags: Employing solubility-enhancing fusion partners specific to photosynthetic proteins

  • In vitro translation systems: Cell-free protein synthesis with added thylakoid membranes

  • Co-expression strategies: Simultaneous expression of chaperones and assembly factors

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.