Recombinant Long-chain-alcohol oxidase FAO1 (FAO1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Long-Chain-Alcohol Oxidase FAO1

Recombinant Long-Chain-Alcohol Oxidase FAO1 (FAO1) refers to a genetically engineered form of the Fatty Alcohol Oxidase 1 enzyme. Naturally occurring in various organisms, including the yeast Yarrowia lipolytica, FAO1 is involved in the oxidation of long-chain fatty alcohols . These enzymes catalyze the breakdown of long-chain alcohols, which is important in various metabolic processes . The recombinant form is produced through genetic engineering techniques, where the gene encoding FAO1 is inserted into a host organism to facilitate large-scale production and detailed study .

Native FAO1: Function and Occurrence

FAO1 enzymes naturally occur in various microorganisms. For example, Pseudomonas aeruginosa possesses an enzyme system, LaoABCR, involved in the oxidation of long-chain alcohols derived from the degradation of pollutants like sodium dodecyl sulfate (SDS) and alkanes . Similarly, in Y. lipolytica, native FAO1 plays a crucial role in fatty alcohol metabolism . Specifically, FAO1 oxidizes $$\omega$$-hydroxy fatty acids but not 2-alkanols, highlighting its substrate specificity .

Production of Recombinant FAO1

To produce recombinant FAO1, the gene encoding the enzyme is typically isolated and inserted into a suitable expression vector. This vector is then introduced into a host organism, such as Escherichia coli or Y. lipolytica, which then produces the enzyme . The choice of host organism and expression vector depends on factors such as the desired yield, ease of purification, and post-translational modifications required for enzyme activity.

Applications of Recombinant FAO1

Recombinant FAO1 has several potential applications:

  • Biocatalysis: Recombinant FAO1 can be used as a biocatalyst for the selective oxidation of long-chain alcohols in chemical synthesis . This can be particularly useful in producing flavor and fragrance compounds.

  • Metabolic Engineering: In metabolic engineering, recombinant FAO1 can be employed to modify metabolic pathways for the production of valuable compounds . For example, deleting FAO1 in Y. lipolytica can prevent the degradation of fatty alcohols, thereby increasing their accumulation .

  • Drug Development: Enzymes and their reaction mechanisms can be studied and applied to drug development. Understanding how enzymes function can help researchers modify systems to function smoothly and obtain the desired product in drug creation .

Table 1: Production of Fatty Alcohols by Engineered Y. lipolytica Strains

StrainRelevant GenotypeC16:0-OHC16:1Δ9-OHLonger FA-OHsTotal FA-OHs
JMY70868UAS-pTEF-BlucFAR1IncreasedIncreasedDecreasedSimilar
JMY70908UAS-pTEF-BlapFAR4DecreasedDecreasedIncreasedSimilar
JMY70948UAS-pTEF-BlucFAR1, 8UAS-pTEF-BlapFAR4IncreasedIncreasedDecreasedDecreased

Table 2: Key Properties of Pseudomonas aeruginosa LaoA and LaoB

ProteinFunctionRole in 1-Dodecanol Oxidation
LaoAPutative Alcohol DehydrogenaseRequired
LaoBProbable Inner Membrane ProteinRequired
LaoRTranscriptional RegulatorRepressor

Future Directions

Further research is needed to fully elucidate the structural and functional properties of recombinant FAO1. This includes:

  • High-resolution Crystal Structures: Determining the crystal structure of recombinant FAO1 would provide detailed insights into its active site and substrate-binding mechanism.

  • Kinetic Studies: Detailed kinetic studies would help to quantify the enzyme's activity with different substrates and under various conditions.

  • Directed Evolution: Employing directed evolution techniques to enhance the enzyme's stability, activity, and substrate specificity.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Products are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAO1; Long-chain-alcohol oxidase FAO1; Long-chain fatty alcohol oxidase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-749
Protein Length
full length protein
Species
Lotus japonicus (Lotus corniculatus var. japonicus)
Target Names
FAO1
Target Protein Sequence
MRKECHPLLRGGRKDNKFRQGFSSSEMESLASICEVILPPLPMDALKIKKHDDVSIEDVE FFWNTSASHYPIPHEVAEILSKRSLIEAVILIRVVLWLLATRLGTFLLCGLLCFSEKWPF INNFSSMSLKKRERVMQWWLKNRFITPIRLAFAYLKVLCLFAYFTWVDENGDNPAWKAIG YEVSADEKLPNSSNGRLLEKGIVETMHETNSTLQQSLTEKGLNVTLDSRNNILKVKCDAI VVGSGCGGGVAASVLSGAGHKVVVLEKGNYFAPRDYSSLEGPSMDQLYETGGILASVDSR ILLLAGSTVGGGSAVNWSACIKTPHEVLKEWSENHNLSLFSTSEYLSAMETVCERIGVTE SCTHEGFQNQVLRKGCQNLGLKVDYVPRNSSGNHFCGSCGYGCPKGEKQGTQDTWLVDAV ENGAVIITGCKAERFLLENNRNGSGRKKKCLGVLAKALSSRVTMKLQIEAKVTISAGGAL LTPPLMISSGLKNKNIGKNLHLHPVLMTWGYFPESTSELKGKIFEGGIITSVHKVPSRDS NSYSDTRAIIETPSLGPGSFASLCPWESGLDFKERMLNYPRTAHLITIIRDKACGQVTTE GRVSYKLSAFDKENMKCGLQQALRILKAAGAVEVGTHRSDGQRVKCGEVSENEMAEFIDS VCPMEGALSPGENWNIYTSAHQMGSCRMGMNEKEGAVDENGESWEAQGLFVCDASLLPTA VGVNPMITIQSTAYCISNRVVDYLKRDQI
Uniprot No.

Target Background

Function
Recombinant Long-chain-alcohol oxidase FAO1 (FAO1) is a long-chain fatty alcohol oxidase involved in the ω-oxidation pathway of lipid degradation.
Database Links

KEGG: ag:CAP15762

UniGene: Lja.16394

Protein Families
GMC oxidoreductase family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Mainly expressed in floral buds and apexes. Detected in roots, stems, leaves, flowers and siliques.

Q&A

What is Long-chain-alcohol oxidase FAO1 and what role does it play in cellular metabolism?

Long-chain-alcohol oxidase (FAO1) functions as a key enzyme in the ω-oxidation pathway, particularly in yeasts like Candida tropicalis and Yarrowia lipolytica. It catalyzes the oxidation of long-chain fatty alcohols to corresponding aldehydes, which are subsequently oxidized to fatty acids . In the ω-oxidation pathway, FAO1 typically acts as the second enzyme, following the initial hydroxylation of fatty acids or alkanes by cytochrome P450 systems. This pathway enables organisms to utilize alkanes and long-chain fatty acids as carbon sources, converting them to dicarboxylic acids that can enter the β-oxidation pathway .

How is the FAO1 gene structured across different species?

The structure of FAO1 genes varies among different organisms. For instance, in Lotus japonicus, the LjFAO1 genomic DNA is approximately 3.6 kb in length and contains 3 exons separated by 2 introns. Comparison between the cDNA and genomic DNA revealed this structure .

In Candida tropicalis (ATCC 20336), researchers have identified three FAO genes - one designated as FAO1 and two putative allelic genes designated as FAO2a and FAO2b. DNA sequence homology and derived amino acid sequence analysis confirmed that FAO1 and FAO2 are distinct genes with different functions .

How are FAO1 genes expressed in different organisms and tissues?

Expression patterns of FAO1 vary significantly between organisms:

  • In Lotus japonicus, RT-PCR analysis showed that LjFAO1 is expressed throughout the plant, with highest expression levels in the apex and lowest levels in the siliques .

  • In Candida tropicalis, FAO1 is highly induced during growth on fatty acids as carbon sources, while FAO2 expression remains relatively low under these conditions .

  • In Yarrowia lipolytica, FAO1 expression is associated with lipid metabolism and is particularly active during the conversion of fatty alcohols to fatty acids .

Environmental factors can also influence expression. For example, LjFAO1 gene expression is down-regulated by cold stress in both the apex and cotyledon of 8-day old seedlings, representing the first documented case of a long-chain alcohol oxidase responding directly to stress conditions .

What are the most effective methods for cloning and expressing recombinant FAO1?

Methodological Approach for FAO1 Cloning and Expression:

  • Gene Identification and Amplification:

    • Identify FAO1 sequences through database searches against known FAO sequences

    • Design specific primers based on conserved regions of the target gene

    • Amplify the gene using PCR from genomic DNA or cDNA libraries

  • Cloning Strategy:

    • Use restriction enzymes to create compatible ends (common combinations include EcoRI and BamHI)

    • For E. coli expression, clone the gene into an appropriate expression vector such as pBK-CMV

    • Include appropriate promoters, such as T7 for strong expression in E. coli

  • Expression System Optimization:

    • E. coli is commonly used for FAO1 expression (DH5α strain has been successful)

    • Culture conditions: Use rich media such as Terrific Broth (TB) with appropriate antibiotics

    • Induction: Optimize induction timing and concentration of inducers like IPTG

    • Temperature: Lower temperatures (25-30°C) often improve soluble protein yield

  • Codon Optimization Considerations:

    • Be aware of codon usage differences between source organism and expression host

    • For example, CTG in Candida tropicalis codes for serine, while in E. coli it codes for leucine

    • Consider synthetic genes with optimized codons for improved expression efficiency

  • Purification Strategy:

    • Utilize affinity tags such as His-tags for purification

    • Ni-NTA chromatography has proven effective for FAO1 purification

How can enzyme activity of recombinant FAO1 be accurately measured?

Standard Protocol for FAO1 Activity Measurement:

  • Hydrogen Peroxide-Based Detection Methods:

    • Amplex Red peroxide detection assay can measure oxidase activity via hydrogen peroxide detection

    • This assay couples H₂O₂ production with peroxidase-catalyzed oxidation of a fluorogenic substrate

  • Substrate Selection for Activity Assays:

    • For FAO1, use long-chain fatty alcohols as substrates (e.g., 1-dodecanol, 1-hexadecanol)

    • For comparison with other FAO enzymes, include ω-hydroxy fatty acids and 2-alkanols in assays

  • Kinetic Parameter Determination:

    • Measure initial reaction rates at varying substrate concentrations

    • Calculate Km values using Lineweaver-Burk or Eadie-Hofstee plots

    • Typical Km values for LjFAO1: 59.6 ± 14.8 (μM) for 1-dodecanol, 40.9 ± 8.2 (μM) for 1-hexadecanol, and 19.4 ± 1.5 (μM) for 1,16-hexadecanediol

  • Activity Assay Conditions:

    • Buffer: Typically phosphate buffer (pH 7.0-8.0)

    • Temperature: 25-37°C depending on enzyme source

    • Include appropriate controls to distinguish FAO1 activity from background reactions

  • Substrate Specificity Analysis:

    • Test a range of substrates including various chain lengths (C8-C22)

    • Compare activity with primary alcohols, secondary alcohols, and ω-hydroxy fatty acids

    • Document the specificity profile to distinguish between FAO1 and other alcohol oxidases

What experimental design principles should be applied when studying FAO1 function?

When designing experiments to study FAO1 function, researchers should apply these key experimental design principles:

  • Define Clear Variables:

    • Independent variables: FAO1 concentration, substrate type/concentration, reaction conditions

    • Dependent variables: Reaction rate, product formation, enzyme stability

    • Control variables: pH, temperature, buffer composition

  • Develop Specific Hypotheses:

    • Formulate null and alternative hypotheses about FAO1 function

    • Example: "H₀: Substrate chain length does not affect FAO1 activity" vs. "H₁: FAO1 has higher activity toward longer-chain alcohols"

  • Implement Controlled Treatments:

    • Use systematic manipulation of independent variables

    • Include appropriate controls (negative controls without enzyme, positive controls with known active enzymes)

    • Consider using wild-type and mutant versions of FAO1 to identify critical residues

  • Ensure Statistical Validity:

    • Perform adequate technical and biological replicates (minimum n=3)

    • Apply appropriate statistical tests based on data distribution

    • Report both statistical significance and effect sizes

  • Validation Across Systems:

    • Test FAO1 function in different expression systems

    • Compare in vitro results with in vivo activity

    • Cross-validate findings using complementary experimental approaches

How does substrate specificity differ between FAO1 and other alcohol oxidases?

A critical distinction in FAO enzymes lies in their substrate specificity patterns, which have significant implications for their biological roles:

Comparative Substrate Specificity of Different FAO Enzymes:

EnzymePrimary Alcoholsω-Hydroxy Fatty Acids2-AlkanolsOptimal Chain LengthSource
FAO1 (C. tropicalis)YesYesNoC12-C16
FAO2 (C. tropicalis)YesNoYesC6-C12
LjFAO1 (L. japonicus)YesYesLimitedC12-C16
FAOT (C. tropicalis)YesYesLimitedC12-C16

The most striking difference is that FAO1 from C. tropicalis efficiently oxidizes ω-hydroxy fatty acids but not 2-alkanols, whereas FAO2 exhibits the opposite specificity, oxidizing 2-alkanols but not ω-hydroxy fatty acids . This fundamental difference in substrate preference suggests distinct evolutionary pathways and physiological roles for these enzymes.

The substrate preference of LjFAO1 shows apparent differences compared to the Arabidopsis homolog AtFAO3, despite their sequence similarity. LjFAO1 exhibits a stronger preference for 1,16-hexadecanediol (Km 19.4 ± 1.5 μM) compared to 1-dodecanol (Km 59.6 ± 14.8 μM) .

What are the functional consequences of FAO1 gene deletion or overexpression in model organisms?

Genetic manipulation of FAO1 has revealed its crucial role in fatty acid metabolism:

In Yarrowia lipolytica:

  • Deletion of FAO1 leads to significant accumulation of ω-hydroxy fatty acids in the culture medium

  • In contrast, deletion of alcohol dehydrogenase genes (FADH, ADH1-7) has only a minor effect on ω-hydroxy fatty acid accumulation

  • Combined deletion of FAO1 and alcohol dehydrogenase genes further reduces dicarboxylic acid formation

  • These findings indicate that FAO1 plays the major role in ω-oxidation of long-chain fatty acids in this organism

In engineered lipid-producing strains:

  • Deletion of FAO1 prevents the conversion of fatty alcohols to fatty acids, increasing fatty alcohol accumulation

  • When combined with deletion of lipases (e.g., TFL4) and acyl-CoA oxidases (POX1-6), FAO1 deletion prevents the consumption of produced fatty alcohols

  • This strategy is valuable for biotechnological production of long-chain fatty alcohols

Overexpression effects:

  • Overexpression of FAO1 can enhance the production of dicarboxylic acids in engineered strains

  • In yeast cells expressing fatty acyl-CoA reductases (FARs), co-expression of FAO1 can reduce the accumulation of fatty alcohols

  • The balance between FAO1 and competing enzymes can be manipulated to control the fatty acid metabolic flux

How does the structure-function relationship in FAO1 contribute to its catalytic mechanism?

While detailed structural information on FAO1 remains limited, analysis of sequence conservation and mutagenesis studies provide insights into structure-function relationships:

  • Cofactor Binding Domains:

    • FAO1 contains conserved domains for binding flavin cofactors, essential for its oxidase activity

    • The enzyme generates hydrogen peroxide during the oxidation reaction, classifying it as a hydrogen peroxide-generating oxidase

  • Substrate Binding Pocket:

    • The distinct substrate specificities between FAO1 and FAO2 suggest differences in their substrate binding sites

    • FAO1's ability to accommodate ω-hydroxy fatty acids indicates a more flexible or extended substrate channel compared to FAO2

  • Critical Residues:

    • The CTG codon at position 177 in FAO2 (encoding serine in C. tropicalis but leucine in E. coli) does not significantly affect substrate specificity or Km values when mutated

    • This suggests that this position is not critical for determining substrate specificity between FAO1 and FAO2

  • Conservation Analysis:

    • Sequence comparisons across different species reveal highly conserved regions likely involved in catalysis or structural integrity

    • Variable regions may explain species-specific differences in substrate preference and regulation

Advanced structural studies using X-ray crystallography or cryo-electron microscopy would provide more detailed insights into the catalytic mechanism of FAO1.

How can FAO1 be utilized in metabolic engineering for production of valuable compounds?

FAO1 has significant potential in metabolic engineering applications:

  • Production of ω-Hydroxy Fatty Acids:

    • Deletion of FAO1 in oleaginous yeasts like Y. lipolytica allows accumulation of valuable ω-hydroxy fatty acids

    • These compounds have applications in polymers, lubricants, and pharmaceuticals

    • Strategic deletion of FAO1 while maintaining other pathway components can optimize production

  • Dicarboxylic Acid Production:

    • Conversely, overexpression of FAO1 can enhance conversion of ω-hydroxy fatty acids to dicarboxylic acids

    • Dicarboxylic acids are important precursors for biodegradable polymers, plasticizers, and adhesives

    • Fine-tuning FAO1 expression levels can control the ratio of hydroxy acids to dicarboxylic acids

  • Fatty Alcohol Production Systems:

    • In systems expressing fatty acyl-CoA reductases for fatty alcohol production, FAO1 deletion prevents re-oxidation of the alcohols

    • Combined with other genetic modifications (deletion of lipases and acyl-CoA oxidases), this approach can significantly increase fatty alcohol yields

    • The fatty alcohols have applications in detergents, cosmetics, and biofuels

  • Balancing Metabolic Pathways:

    • FAO1 manipulation allows for fine control of carbon flux through competing pathways

    • This enables optimization of target compound production while minimizing unwanted byproducts

What are the current experimental challenges in FAO1 research and how can they be addressed?

Researchers face several challenges when working with FAO1:

  • Expression and Solubility Issues:

    • FAO1 can form inclusion bodies when overexpressed in bacterial systems

    • Solution: Optimize expression conditions by lowering temperature (25-30°C), using solubility-enhancing fusion tags, or expressing in eukaryotic hosts like Pichia pastoris

  • Enzyme Stability:

    • FAO1 may exhibit limited stability in vitro after purification

    • Solution: Include stabilizing agents in buffer systems, optimize storage conditions, or engineer more stable variants through directed evolution

  • Codon Usage Differences:

    • Different codon preferences between source organisms and expression hosts can affect expression

    • Solution: Use codon-optimized synthetic genes or choose appropriate expression hosts (as demonstrated with the CTG codon issue in C. tropicalis FAO2)

  • Assay Limitations:

    • Traditional H₂O₂-based detection methods may have limitations with certain substrates

    • Solution: Develop alternative assay methods, such as direct detection of aldehyde products or oxygen consumption measurements

  • Substrate Availability:

    • Some long-chain substrates have limited solubility in aqueous systems

    • Solution: Use solubilizing agents, mixed solvent systems, or develop microfluidic approaches for handling hydrophobic substrates

How can machine learning and computational approaches advance FAO1 research?

Computational methods offer powerful tools for advancing FAO1 research:

  • Protein Structure Prediction:

    • Modern deep learning approaches like AlphaFold2 can predict FAO1 structure with high accuracy

    • These models can provide insights into substrate binding pockets and catalytic mechanisms

    • Predicted structures can guide rational design of FAO1 variants with altered specificity or activity

  • Machine Learning for Directed Evolution:

    • ML-guided library design can accelerate the engineering of FAO1 for desired properties

    • Feature vectors combining physical properties (Z-scale) and evolutionary information (PSSM) have proven effective for predicting enzyme performance

    • This approach can substantially reduce screening efforts by prioritizing promising variants

  • Sequence-Function Relationship Analysis:

    • Large-scale sequence analysis combined with experimental data can identify patterns that predict enzyme function

    • For example, analysis of FAO sequences from diverse organisms can reveal residues that differentiate between FAO1 and FAO2-like activities

  • Metabolic Modeling:

    • Genome-scale metabolic models incorporating FAO1 can predict the effects of genetic modifications

    • These models can guide the design of optimized strains for specific biotechnological applications

The application of recent advances in ML and computational biology to FAO1 research presents a promising frontier for both understanding fundamental enzyme properties and developing biotechnological applications.

Why might recombinant FAO1 show lower activity than expected, and how can this be addressed?

Several factors can contribute to lower-than-expected activity in recombinant FAO1:

  • Improper Folding:

    • FAO1 may not fold correctly in heterologous expression systems

    • Solution: Try different expression hosts (bacterial vs. yeast), fusion tags, or co-expression with chaperones

  • Cofactor Limitations:

    • FAO1 requires flavin cofactors for activity

    • Solution: Ensure sufficient flavin (FAD or FMN) in expression medium or add during purification/assay

  • Post-translational Modifications:

    • Native FAO1 may require specific post-translational modifications absent in recombinant systems

    • Solution: Consider eukaryotic expression systems like Pichia pastoris or Saccharomyces cerevisiae

  • Inhibitory Compounds:

    • Expression media components or purification additives may inhibit FAO1 activity

    • Solution: Test enzyme activity in different buffer systems, dialyze thoroughly, or use size exclusion chromatography to remove potential inhibitors

  • Substrate Accessibility:

    • Poor substrate solubility or accessibility may limit apparent activity

    • Solution: Optimize substrate delivery using detergents, organic solvents (at non-inhibitory concentrations), or substrate analogs with better solubility

How can experimental design be optimized for studying substrate specificity of FAO1?

An optimized experimental design for studying FAO1 substrate specificity should include:

  • Substrate Panel Design:

    • Include structurally diverse substrates to comprehensively map specificity

    • Test a range of chain lengths (C6-C22) to determine optimal substrate size

    • Include both saturated and unsaturated fatty alcohols, ω-hydroxy fatty acids, and 2-alkanols

    • Use structurally related non-substrates as negative controls

  • Assay Method Selection:

    • Choose assay methods compatible with all substrates being tested

    • Consider using multiple detection methods in parallel (H₂O₂ detection, oxygen consumption, product formation)

    • Validate assay linearity across the concentration range for each substrate

  • Experimental Controls:

    • Include enzyme-free controls for each substrate to account for auto-oxidation

    • Use known active enzymes (e.g., commercial alcohol oxidases) as positive controls

    • Test heat-inactivated FAO1 to confirm enzyme-dependent activity

  • Data Analysis Plan:

    • Determine appropriate kinetic parameters (kcat, Km, kcat/Km) for each substrate

    • Use relative activity profiles rather than single-point measurements

    • Employ multivariate analysis to identify patterns in substrate preference

  • Validation Strategy:

    • Confirm key findings using alternative assay methods

    • Test selected substrates under various reaction conditions to identify optimal parameters

    • Consider structure-activity relationship analysis to identify key substrate features

What strategies can resolve contradictory findings in FAO1 research literature?

When facing contradictory findings in FAO1 literature, consider these approaches:

  • Source Organism Differences:

    • FAO1 enzymes from different organisms may have divergent properties despite similar names

    • Solution: Carefully compare the exact source organisms and sequence identities between studies

  • Expression System Variations:

    • Different expression systems can yield enzymes with varying properties

    • Solution: Directly compare enzymes expressed in identical systems, or express the contradictory enzymes under standardized conditions

  • Assay Method Discrepancies:

    • Different activity assay methods may measure different aspects of enzyme function

    • Solution: Apply multiple assay methods to the same enzyme preparations to reconcile differences

  • Isoform Confusion:

    • Studies may inadvertently examine different isoforms or closely related enzymes

    • Solution: Perform detailed sequence analysis and use specific genetic or biochemical markers to confirm enzyme identity

  • Systematic Comparative Analysis:

    • Design experiments specifically to address contradictions

    • Solution: Include side-by-side testing of enzymes under identical conditions, preferably with positive controls from previous studies

By applying these strategies, researchers can resolve apparent contradictions and develop a more coherent understanding of FAO1 biology and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.