Recombinant Long-chain-alcohol oxidase FAO2 (FAO2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FAO2; Long-chain-alcohol oxidase FAO2; Long-chain fatty alcohol oxidase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-750
Protein Length
full length protein
Species
Lotus japonicus (Lotus corniculatus var. japonicus)
Target Names
FAO2
Target Protein Sequence
MEREESCETHPLLKGGRRKEKGYSHGLSSSQMHVIAAICEALFPSQPLDSQNNQSSVDKA LSAFYTASGSQAPLPDEAAELLFKFNRSFPEALSLVSWVLLILSFRLGTLLLCGTLCLDW RWPFIHKFSEIPLEKREEILKRWSREKCWIPLRLVFVLTKLVCFYNLFSRADVNGHNPIW KAIGYQVDTREKLTQKKRPLQEGLIETMYETDSTLIQSLTEKGLEVTEDLEQNMYKIKCD AVIVGSGCGGGVAAAVLANSGHKVIILEKGEYFVSHDYSSLEGPSMNELYESGGILPSLD GKMMILAGSTLGGXSAINWSACIRTPDSVLREWSEKHKIPLFASPDYQSAMDTVCRRIGV TENCNKESFQNQILRQGCAKIGFKVEPVAINSSADHYCGSCCYGCRTGDKKGTESTWLVD AVGNGAVILTGCKAEKLNFTLKDGDNGTKRKTCSGVIASATWRSKVTKKLQIESKVTISA CGSLSTPPLMISSGLKNPNIGKNLHLHPCQFAWGYFPEDMTNFSGNNYEGGIITSIHKVF EEDSTSTPRIIIEAPALGPGSFSALVPWVSGLDVKERMVKYARTANLFALVRDHGSGEVK AEGRISYKLDKIDRESLQTGLRKALRILVAAGAVEVGTYRSDGQRIKCRGIKESDLEEFL DSVRVVGGPSSRNEVWTVFTSAHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLP SAVGVNPMITIQSTAYCIASNIAESLKKQN
Uniprot No.

Target Background

Function
Recombinant Long-chain-alcohol oxidase FAO2 (FAO2) is a long-chain fatty alcohol oxidase involved in the ω-oxidation pathway of lipid degradation.
Database Links

UniGene: Lja.3526

Protein Families
GMC oxidoreductase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Long-chain-alcohol oxidase FAO2?

Recombinant Long-chain-alcohol oxidase FAO2 is one of three fatty alcohol oxidase genes (the others being FAO1 and a potential allele of FAO2 called FAO2b) that have been cloned and sequenced from Candida tropicalis. FAO2 encodes an enzyme that catalyzes the oxidation of specific alcohols to aldehydes. Unlike its counterpart FAO1, FAO2 has a distinctive substrate specificity profile, being capable of oxidizing 2-alkanols but not ω-hydroxy fatty acids. This enzyme plays a significant role in fatty acid metabolism pathways and has been studied for its potential applications in biotechnology and research settings. The recombinant form refers to the protein expressed in heterologous systems such as Escherichia coli, where it can be produced in substantial quantities for detailed biochemical characterization and application development .

How does the substrate specificity of FAO2 differ from other alcohol oxidases?

FAO2 demonstrates a unique substrate specificity profile that clearly distinguishes it from other alcohol oxidases. Most notably, FAO2 actively oxidizes 2-alkanols but lacks activity toward ω-hydroxy fatty acids. This contrasts sharply with FAO1 from the same organism, which exhibits the opposite specificity pattern – oxidizing ω-hydroxy fatty acids but not 2-alkanols . This complementary substrate specificity suggests these enzymes evolved to handle different aspects of alcohol metabolism in Candida tropicalis. The substrate preference differs significantly from alcohol oxidases found in other organisms, such as the aryl alcohol oxidase from Aspergillus terreus, which preferentially oxidizes aromatic alcohols with a substrate preference hierarchy of 4-methoxybenzyl alcohol > 3-methoxybenzyl alcohol > 3,4-dimethoxybenzyl alcohol > benzyl alcohol . These distinct specificity profiles make FAO2 valuable for selective biotransformation applications where specific alcohol oxidation is required.

What is known about the genetic structure and expression patterns of FAO2?

FAO2 contains a notable genetic feature in its coding sequence - the presence of a CTG codon at position 177, which codes for serine in Candida tropicalis but codes for leucine when expressed in E. coli due to differences in codon usage between these organisms. Research has shown that substituting this codon with TCG (which codes for serine in both organisms) does not significantly alter the substrate specificity or kinetic parameters of the enzyme, suggesting this particular residue may not be critical for catalytic function . Regarding expression patterns, analysis of C. tropicalis strain H5343 during growth on fatty acids indicated that FAO2 is not highly induced under these conditions, unlike FAO1 which shows substantial upregulation. This differential expression pattern suggests distinct regulatory mechanisms and physiological roles for these two enzymes, with FAO1 appearing to be the predominant fatty alcohol oxidase involved in fatty acid metabolism under inducing conditions .

What are the optimal conditions for cloning and expressing FAO2?

Successful cloning and expression of FAO2 involve specific molecular techniques and conditions. For cloning, researchers have employed PCR-based approaches using primers designed to incorporate appropriate restriction sites (such as EcoRI and BamHI) to facilitate subsequent subcloning. The specific primers reported for amplification of FAO2 are 5′-CCAGTGAATTCAGATGAATACCTTCT-3′ (forward primer) and 5′-CCGGATCCCCGTCTCACTACAACTTG-3′ (reverse primer) . For expression in E. coli, a common host-vector system involves using Terrific Broth (TB) supplemented with ampicillin (100 μg/ml). Optimal induction conditions include growing cultures at 30°C with vigorous shaking (250 rpm). The expression system typically yields functional recombinant enzyme that can be purified for subsequent biochemical characterization . When considering codon optimization, researchers should be aware of the CTG codon issue, with the option to substitute it with TCG to ensure proper amino acid incorporation in E. coli, although studies have shown this substitution does not substantially alter enzyme properties .

How does codon usage affect heterologous expression of FAO2?

Codon usage presents a significant consideration in heterologous expression of FAO2, particularly due to the presence of the CTG codon at position 177 which encodes serine in Candida tropicalis but leucine in Escherichia coli. This codon divergence creates an interesting research question regarding the impact of amino acid substitution on enzyme structure and function. Experimental evidence demonstrates that researchers addressed this challenge by creating an FAO2a construct with a TCG codon (encoding serine in E. coli) substituted for the CTG codon. Interestingly, comprehensive analysis revealed that neither the substrate specificity nor the kinetic parameters for the FAO2a variant with serine at position 177 differed radically from those of the variant expressing leucine at that position . This finding suggests that this particular residue may not be critical for the catalytic mechanism or substrate binding characteristics of FAO2. Nevertheless, researchers designing expression systems for FAO2 should consider broader codon optimization strategies beyond this single position to maximize protein yield and proper folding, especially when targeting expression hosts with significantly different codon usage preferences than the native organism.

What structural features determine the unique substrate specificity of FAO2?

The distinctive substrate specificity of FAO2 - particularly its ability to oxidize 2-alkanols but not ω-hydroxy fatty acids - likely stems from specific structural features of the enzyme's active site. Although the search results don't provide detailed structural information specific to FAO2, comparative analysis with other alcohol oxidases offers valuable insights. For instance, structural studies of aryl alcohol oxidase from Pleurotus eryngii, which shares homology with alcohol oxidases, reveal that substrate specificity is largely determined by the architecture of the substrate binding pocket and the positioning of the FAD cofactor . In FAO2, the arrangement of amino acid residues in the active site likely creates a microenvironment that accommodates the hydroxyl group at the C2 position of alcohols but excludes molecules with terminal hydroxyl groups. Research approaches to elucidate these structural determinants would include X-ray crystallography or cryo-electron microscopy of FAO2 in complex with substrates or substrate analogs, computational modeling of enzyme-substrate interactions, and site-directed mutagenesis studies targeting residues predicted to interact with the substrate. These approaches would provide crucial insights into the molecular basis of FAO2's unique specificity profile.

How can protein engineering be used to modify FAO2 substrate specificity?

Protein engineering of FAO2 represents an advanced research approach to expand or alter its substrate specificity profile for biotechnological applications. A systematic engineering strategy would begin with detailed structural analysis and computational modeling to identify key residues involved in substrate binding and catalysis. Based on structural insights from related alcohol oxidases, researchers could target specific amino acid residues through site-directed mutagenesis to alter the enzyme's active site architecture. For example, mutations that enlarge the substrate binding pocket might accommodate bulkier alcohol substrates, while alterations to the hydrophobicity of the binding pocket could influence chain-length specificity. Directed evolution approaches, including error-prone PCR and DNA shuffling followed by high-throughput screening, could generate FAO2 variants with novel activities. The screening system would need to detect oxidation of desired target substrates, potentially using colorimetric assays that detect aldehyde formation or hydrogen peroxide production. Successful protein engineering efforts with related enzymes suggest that FAO2 could be modified to accept a broader range of substrates or to function under different reaction conditions . The impact of such modifications would require careful kinetic characterization to assess changes in substrate affinity, catalytic efficiency, and potential shifts in reaction mechanisms.

What are the kinetic parameters of FAO2 for different alcohol substrates?

The kinetic characterization of FAO2 with different alcohol substrates provides crucial information about its catalytic efficiency and substrate preference. While the search results don't provide comprehensive kinetic parameters specifically for FAO2 with all substrates, we can draw insights from the provided information. FAO2 demonstrates activity toward 2-alkanols but not toward ω-hydroxy fatty acids, indicating a clear substrate preference . Kinetic parameters would typically include Km (reflecting substrate affinity), kcat (turnover number), and kcat/Km (catalytic efficiency). For comparison, related alcohol oxidases such as the aryl alcohol oxidase from Aspergillus terreus show remarkably high catalytic efficiency (kcat/Km) of 7829.5 min⁻¹mM⁻¹ for 4-methoxybenzyl alcohol, indicating efficient catalysis with this preferred substrate . A comprehensive kinetic analysis of FAO2 would involve steady-state enzyme kinetics with various 2-alkanols of different chain lengths to establish structure-activity relationships. Researchers should employ standardized assay conditions and analytical methods such as spectrophotometric monitoring of cofactor reduction or product formation, or HPLC analysis of substrate consumption and product formation rates. These kinetic parameters would provide valuable insights into the substrate specificity range and catalytic mechanism of FAO2, guiding its application in both research and biotechnological contexts.

What experimental design principles should be applied when studying FAO2?

When designing experiments to study FAO2, researchers should adhere to fundamental principles of experimental design to ensure valid and reproducible results. First, clearly define your research questions and formulate testable hypotheses about FAO2 function, regulation, or applications. Identify independent variables (such as substrate concentrations, pH, temperature, or specific mutations) and dependent variables (enzyme activity, expression levels, or product formation) . Control for extraneous variables by maintaining consistent experimental conditions across all tests. Implement appropriate controls, including negative controls (reactions without enzyme) and positive controls (reactions with well-characterized related enzymes). For complex multi-factorial experiments investigating multiple parameters simultaneously, consider using factorial or fractional factorial designs to efficiently explore interaction effects . When comparing different FAO2 variants or conditions, ensure sufficient replication (typically 3-5 independent experiments) to enable robust statistical analysis. Follow a systematic approach: begin with preliminary experiments to establish working ranges for key variables, then proceed to more detailed characterization studies. Document all experimental protocols in detail, including reagent sources, equipment specifications, and data processing methods to ensure reproducibility. This structured approach will yield more reliable insights into FAO2 properties and functions.

How should activity assays for FAO2 be designed and optimized?

Designing robust activity assays for FAO2 requires careful consideration of reaction conditions, detection methods, and controls. Begin by selecting an appropriate assay principle based on either substrate disappearance or product formation. For FAO2, which oxidizes alcohols to aldehydes with concomitant reduction of oxygen to hydrogen peroxide, several detection strategies are available. A commonly used approach involves coupling hydrogen peroxide formation to a peroxidase-catalyzed reaction with a chromogenic substrate, enabling spectrophotometric monitoring of enzyme activity. Alternatively, direct measurement of oxygen consumption using an oxygen electrode, or aldehyde formation using spectrophotometric or chromatographic methods may be employed. When optimizing the assay, systematically investigate the effects of pH (typically testing a range from 6.0-9.0), temperature (25-40°C), buffer composition, and ionic strength on enzyme activity. Determine the linear range of the assay with respect to enzyme concentration and reaction time to ensure measurements are taken under initial velocity conditions. Establish appropriate substrate concentration ranges based on preliminary Km determinations to avoid substrate limitation or inhibition effects. Incorporate specific controls to account for non-enzymatic oxidation of substrates and the potential presence of interfering activities in complex samples. Validate the assay by demonstrating proportionality between enzyme amount and measured activity, and by confirming specificity using known inhibitors or substrate analogs that do not serve as substrates for FAO2 .

How can researchers effectively purify FAO2 while maintaining enzyme activity?

Purification of recombinant FAO2 while preserving enzyme activity requires a strategic approach that balances purification yield with retention of catalytic function. Begin with careful cell lysis under mild conditions, preferably using enzymatic methods (lysozyme treatment) or gentle mechanical disruption (sonication with cooling intervals) to prevent protein denaturation. Include protease inhibitors in all buffers to prevent enzymatic degradation. For initial capture, immobilized metal affinity chromatography (IMAC) is often effective if the recombinant FAO2 contains a histidine tag, though researchers should verify that the tag doesn't interfere with enzyme activity. Ion exchange chromatography represents another viable first-step option, with the choice between cation or anion exchange depending on the isoelectric point of FAO2 (related alcohol oxidases have shown isoelectric points around 6.5) . For further purification, size exclusion chromatography can separate FAO2 from contaminants of different molecular weights while simultaneously performing buffer exchange to optimal storage conditions. Throughout purification, monitor enzyme activity using the validated activity assay to track recovery of functional protein. Consider incorporating stabilizing agents such as glycerol (10-20%) or specific substrates in purification buffers to protect the active site. For long-term storage, determine optimal conditions through stability studies testing various buffers, pH values, and additives like glycerol or reducing agents. Aliquot the purified enzyme and store at -80°C to minimize freeze-thaw cycles. Document purification yields, specific activities, and purity assessments at each step to establish a reproducible purification protocol .

How do you troubleshoot low FAO2 activity in recombinant expression systems?

When encountering low FAO2 activity in recombinant expression systems, a systematic troubleshooting approach is essential. First, verify protein expression levels using SDS-PAGE and Western blotting to determine if the issue stems from poor expression or inactive protein. If expression levels are adequate but activity is low, consider examining protein folding and solubility. FAO2, like other oxidases, requires proper folding for activity, and inclusion body formation in E. coli is a common issue. Modify expression conditions by reducing incubation temperature (16-25°C), decreasing inducer concentration, or using specialized E. coli strains designed for improved protein folding. The potential loss of the FAD cofactor during purification may significantly reduce activity. Consider incorporating FAD supplementation during cell lysis and purification, or implement a reconstitution step with extended incubation of the apo-enzyme with FAD. For instance, a related alcohol oxidase required incubation with FAD for approximately 80 hours at 16°C and pH 9.0 to achieve optimal activity . Examine whether the CTG codon issue (encoding serine in C. tropicalis but leucine in E. coli) is affecting enzyme function, though research suggests this specific substitution may not significantly alter activity . Evaluate buffer conditions carefully, as oxidases often have specific pH and ionic strength requirements for optimal activity. Finally, verify that the activity assay itself is functioning properly by including positive controls and checking for potential interfering compounds in your samples.

What statistical approaches are appropriate for analyzing FAO2 kinetic data?

Analysis of FAO2 kinetic data requires appropriate statistical approaches to ensure reliable and meaningful interpretation. For basic kinetic parameter determination, non-linear regression analysis should be employed to fit experimental data to the Michaelis-Menten equation or alternative models (such as Hill equation for cooperative binding or competitive/non-competitive inhibition models when inhibitors are present). Software packages like GraphPad Prism, R, or Python with specialized libraries offer robust tools for this purpose. When comparing kinetic parameters between different FAO2 variants or conditions, employ appropriate statistical tests: t-tests for comparing two conditions, or ANOVA followed by post-hoc tests (such as Tukey's HSD) when comparing multiple conditions . For complex experimental designs with multiple factors, factorial ANOVA can help identify main effects and interactions between variables such as pH, temperature, or substrate structure on enzyme kinetics. Ensure that assumptions for statistical tests are met; for instance, check for normality of residuals and homogeneity of variances. Report both the best-fit values for kinetic parameters (Km, Vmax, kcat, kcat/Km) and their confidence intervals to indicate precision. For substrate specificity comparisons across multiple substrates, consider multivariate statistical approaches such as principal component analysis to identify patterns in the kinetic data. When analyzing time-course data or inactivation kinetics, regression analysis with appropriate decay models should be applied. Remember that biological replicates (independent experiments) are essential for meaningful statistical analysis, with a minimum of three replicates typically required for basic statistical validation .

How can researchers distinguish between FAO1 and FAO2 activity in complex biological samples?

Distinguishing between FAO1 and FAO2 activities in complex biological samples requires leveraging their distinct substrate specificity profiles. FAO1 oxidizes ω-hydroxy fatty acids but not 2-alkanols, while FAO2 displays the opposite pattern, oxidizing 2-alkanols but not ω-hydroxy fatty acids . This complementary substrate specificity offers a practical approach for differential activity measurements. Design parallel assays using 2-alkanols (specific for FAO2) and ω-hydroxy fatty acids (specific for FAO1) as substrates under identical reaction conditions. The activity measured with 2-alkanols can be attributed primarily to FAO2, while activity with ω-hydroxy fatty acids indicates FAO1 presence. For more complex samples containing multiple oxidases, immunological methods using specific antibodies against FAO1 and FAO2 can help quantify each enzyme through techniques such as enzyme-linked immunosorbent assay (ELISA) or immunoprecipitation followed by activity measurements. Genetic approaches provide another avenue for differentiation; design specific primers for FAO1 and FAO2 to quantify their respective mRNA levels using quantitative PCR, which can serve as a proxy for potential enzyme activities. Chromatographic separation techniques can physically separate FAO1 and FAO2 based on their different physicochemical properties before activity measurements. Additionally, selective inhibition strategies may be developed if specific inhibitors with substantially different potencies against FAO1 versus FAO2 can be identified through screening approaches. Combining these complementary approaches provides robust discrimination between FAO1 and FAO2 activities in complex biological matrices .

What are the future research directions for FAO2?

Future research on FAO2 presents numerous exciting opportunities spanning basic biochemistry to applied biotechnology. Structural biology approaches, including X-ray crystallography and cryo-electron microscopy, would provide valuable insights into the three-dimensional architecture of FAO2, particularly the structural basis for its unique substrate specificity toward 2-alkanols but not ω-hydroxy fatty acids . This structural information would facilitate rational protein engineering efforts to modify substrate scope, stability, or cofactor dependence. Comprehensive comparative studies between FAO1 and FAO2 could elucidate how these related enzymes evolved distinct but complementary substrate preferences within the same organism. Investigation of the physiological roles of FAO2 in Candida tropicalis through approaches such as gene knockout or controlled expression would enhance understanding of its importance in cellular metabolism. Development of immobilization techniques for FAO2 could lead to reusable biocatalysts for selective oxidation reactions in synthetic chemistry applications. Advanced protein engineering using directed evolution or computational design approaches might generate FAO2 variants with enhanced stability, activity, or novel substrate ranges. In applied research, exploring the utility of FAO2 in biosensor development for detecting specific alcohols could yield valuable analytical tools. Additionally, investigating the potential of FAO2 in bioremediation applications, particularly for degrading specific alcohols in environmental settings, represents an intriguing avenue for future exploration. Collaborative, interdisciplinary approaches combining molecular biology, biochemistry, computational science, and engineering will likely accelerate progress in understanding and applying this interesting enzyme .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.