Recombinant Lophuromys flavopunctatus Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Lophuromys flavopunctatus Cytochrome c Oxidase Subunit 2 (MT-CO2)

Lophuromys flavopunctatus refers to the yellow-spotted brush-furred rat, a rodent species belonging to the Muridae family . It populates regions within Angola, the Democratic Republic of the Congo, Ethiopia, Kenya, Malawi, Mozambique, South Sudan, Tanzania, and Zambia . Cytochrome c oxidase subunit 2 (MT-CO2), also known as Cytochrome c oxidase polypeptide II, is a protein encoded by the mitochondrial genome in this species . Recombinant Lophuromys flavopunctatus Cytochrome c oxidase subunit 2 (MT-CO2) is produced using an in vitro E. coli expression system .

Basic Information

FeatureDescription
Product CodeCSB-CF655747LBAP
Uniprot No.Q38S47
Product TypeTransmembrane Protein
Immunogen SpeciesLophuromys flavopunctatus (Yellow-spotted brush-furred rat)
Sourcein vitro E.coli expression system
Target NamesMT-CO2
Protein NamesCytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II
Expression Region1-227
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull length protein
StorageStore at -20°C, for extended storage, conserve at -20°C or -80°C . Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week .
Shelf LifeLiquid form: 6 months at -20°C/-80°C. Lyophilized form: 12 months at -20°C/-80°C .
Amino Acid SequenceMAYPFQLGLQDASSPIMEELTNFHDHTLMIVFLISSLVLYIISSMLTTKMTHTSTMDAQEVETIWTVLPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYESLCFDSYMVPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLNQATLTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSTSMI

Function and Significance

Cytochrome c oxidase (COX), a crucial enzyme in the mitochondrial respiratory chain, catalyzes the final step of electron transfer in oxidative phosphorylation . This process is essential for ATP (adenosine triphosphate) production, the primary energy currency of the cell. Subunit 2 (MT-CO2) is one of the core subunits of this enzyme, playing a vital role in electron transfer and proton pumping activities .

Research Applications

Recombinant MT-CO2 proteins are valuable tools in various research areas:

  1. Structural Biology: Recombinant MT-CO2 can be used for structural studies to understand the protein's three-dimensional structure and its interactions with other subunits and molecules.

  2. Enzyme Kinetics: Researchers can use the recombinant protein to study the enzyme's kinetic parameters, such as its affinity for substrates and its catalytic efficiency.

  3. Drug Discovery: MT-CO2 is a potential drug target for treating mitochondrial diseases and cancer. Recombinant MT-CO2 can be used in drug screening assays to identify compounds that modulate its activity.

  4. Antibody Development: Recombinant MT-CO2 can be used to generate antibodies for detecting and quantifying the protein in biological samples.

  5. Evolutionary Studies: Comparing the MT-CO2 sequences across different species can provide insights into the evolutionary relationships between organisms.

Considerations for Usage

  • Repeated freezing and thawing should be avoided to maintain the stability of the recombinant protein .

  • Working aliquots should be stored at 4°C for no more than one week .

  • The shelf life depends on storage conditions, buffer ingredients, and the protein's inherent stability . Liquid form typically maintains stability for 6 months at -20°C/-80°C, while lyophilized form can last up to 12 months under the same conditions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to ensure contents settle. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
MT-CO2; COII; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Lophuromys flavopunctatus (Yellow-spotted brush-furred rat)
Target Names
Target Protein Sequence
MAYPFQLGLQDASSPIMEELTNFHDHTLMIVFLISSLVLYIISSMLTTKMTHTSTMDAQE VETIWTVLPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYESLCFDS YMVPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSTSMI
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) comprising heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Lophuromys flavopunctatus Cytochrome c oxidase subunit 2 and its significance?

Recombinant Lophuromys flavopunctatus Cytochrome c oxidase subunit 2 (MT-CO2) is a protein derived from the Yellow-spotted brush-furred rat (Lophuromys flavopunctatus). It represents the second subunit of cytochrome c oxidase (Complex IV), which plays a crucial role in the mitochondrial respiratory chain. The protein consists of 227 amino acids with a molecular weight of approximately 25.6 kDa, similar to human MT-CO2. Its amino acid sequence includes key functional regions such as transmembrane domains and metal-binding sites .

The significance of studying this specific protein lies in comparative mitochondrial research, evolutionary biology, and understanding species-specific adaptations in respiratory function. The recombinant form allows researchers to investigate its properties in isolation from other cellular components, enabling detailed structural and functional analyses.

How does the structure of MT-CO2 relate to its function?

MT-CO2 contains several key structural features that directly enable its function in the electron transport chain:

  • N-terminal domain with two transmembrane alpha-helices that anchor the protein in the inner mitochondrial membrane

  • A conserved binuclear copper A center (CuA) located in a cysteine loop at positions 196 and 200, with a conserved histidine at position 204

  • Specific redox centers that facilitate electron transfer from cytochrome c to oxygen

These structural elements allow MT-CO2 to participate in proton pumping across the inner mitochondrial membrane, contributing to the chemiosmotic gradient that drives ATP synthesis. The binuclear copper center specifically serves as the primary electron acceptor from cytochrome c, making it critical for the initial steps of oxygen reduction.

What are the optimal conditions for handling and storing recombinant MT-CO2?

Based on standard protocols for this recombinant protein, researchers should adhere to the following storage and handling guidelines:

  • Store the protein at -20°C for regular use or at -80°C for extended storage periods

  • Avoid repeated freeze-thaw cycles, which can lead to protein degradation and loss of function

  • Working aliquots can be maintained at 4°C for up to one week

  • The protein is typically provided in a Tris-based buffer containing 50% glycerol, optimized for stability

For experimental work, researchers should consider that the optimal buffer conditions may vary depending on the specific application (e.g., enzymatic assays, structural studies, or interaction experiments).

How can isotope tracing approaches be used to study MT-CO2 function in carbon metabolism?

Isotope tracing represents a powerful methodology for investigating MT-CO2 function in relation to carbon metabolism and respiratory chain activity. Researchers can implement several approaches:

  • Carbon-14 labeling: Using 14CO2 allows tracking of carbon movement between organisms and their symbionts, as demonstrated in plant-fungal symbiosis studies. This approach can be adapted to trace carbon flow through respiratory complexes containing MT-CO2 .

  • Phosphorus-33 and Nitrogen-15 tracing: These isotopes can be employed to understand how nutrient exchange relates to electron transport chain efficiency. While not directly measuring MT-CO2 function, these approaches provide context for understanding mitochondrial performance .

  • Experimental design considerations:

IsotopeApplicationDetection MethodExperimental Duration
14CCarbon allocation and fixationScintillation countingShort (hours to days)
33PPhosphorus transport and utilizationScintillation countingMedium (days)
15NNitrogen metabolism and protein synthesisMass spectrometryLong (days to weeks)

When implementing isotope tracing for MT-CO2 research, careful control experiments must be included to distinguish specific protein activity from background metabolic processes. Quantification requires specialized equipment and appropriate statistical analysis to account for natural isotope abundance.

How does atmospheric CO2 concentration affect MT-CO2 function?

The relationship between atmospheric CO2 concentration and MT-CO2 function represents an important area of research given climate change concerns. Evidence from studies on plant-fungal symbiotic systems suggests complex relationships between CO2 levels and mitochondrial function:

  • Carbon allocation patterns: Under elevated atmospheric CO2 (800 ppm vs. ambient 440 ppm), carbon allocation to fungi by host plants may increase by approximately 2.8 times, suggesting potential changes in mitochondrial respiration demands .

  • Nutrient exchange dynamics: Despite increased carbon transfer under elevated CO2, studies with Mucoromycotina fine root endophytes showed no significant increase in phosphorus (33P) or nitrogen (15N) transfer to plants, suggesting respiratory function may be partially decoupled from nutrient acquisition under changing atmospheric conditions .

  • Implications for MT-CO2 function: These findings suggest that MT-CO2 and the respiratory chain may operate under altered regulatory mechanisms when organisms experience elevated CO2, with potential implications for energy production efficiency and metabolic balance.

When designing experiments to investigate MT-CO2 function under varied CO2 conditions, researchers should consider using controlled environmental chambers and appropriate physiological measurements to correlate respiratory activity with protein function.

What methodological approaches are most effective for studying MT-CO2 structure-function relationships?

Several complementary methodologies can be employed to investigate structure-function relationships in recombinant Lophuromys flavopunctatus MT-CO2:

  • Site-directed mutagenesis: Creating targeted mutations in conserved residues, particularly in the copper-binding domain (positions 196, 200, and 204), can reveal the importance of specific amino acids for electron transfer activity .

  • Spectroscopic analyses: UV-visible spectroscopy, circular dichroism, and EPR can provide information about the metal centers and secondary structure of the protein, allowing correlation between structural changes and functional outcomes.

  • Oxygen consumption assays: Direct measurement of cytochrome c oxidase activity using oxygen electrodes can quantify the functional consequences of structural modifications.

  • Crystallography and cryo-EM: Though technically challenging, structural determination methods can provide atomic-level insights into MT-CO2 configuration and its interactions with other subunits.

How should researchers design experiments to study recombinant MT-CO2 in bioreactor systems?

When designing bioreactor experiments to study recombinant MT-CO2 function or production, researchers should consider the following methodological approach:

  • Bioreactor configuration: Gas-permeable membrane bioreactors provide advantages for respiratory studies, allowing controlled gas exchange that mimics physiological conditions. This approach has been successfully implemented in recombinant protein production systems .

  • Media composition: For optimal expression, systems typically require:

    • Base medium with appropriate carbon source

    • Dry salts that are rehydrated for cultivation

    • Specific inducers for expression systems

    • Consideration of oxygen tension and CO2 concentration

  • Monitoring parameters: Key variables to measure include:

    • Dissolved oxygen concentration

    • pH stability

    • Protein expression levels

    • Enzymatic activity of the expressed MT-CO2

    • Biomass accumulation rate

  • Purification strategy: Downstream processing should include:

    • Initial clarification (centrifugation/filtration)

    • Capture chromatography

    • Polishing steps

    • Activity verification

These considerations ensure that experiments yield functionally active recombinant protein suitable for subsequent biochemical and structural investigations.

What are the critical controls needed in experiments investigating MT-CO2 function?

Proper experimental controls are essential for robust MT-CO2 functional studies:

Control TypePurposeImplementation
Negative controlsEstablish baseline and non-specific effectsHeat-inactivated MT-CO2; MT-CO2 with inhibited copper centers
Positive controlsVerify assay functionalityWell-characterized MT-CO2 from model organisms (e.g., human, mouse)
System controlsAccount for experimental variablesBuffer-only reactions; non-respiratory proteins
Specificity controlsConfirm reaction specificityCytochrome c oxidase inhibitors (e.g., cyanide, azide)
Technical replicatesAddress measurement variabilityMinimum triplicate measurements
Biological replicatesAccount for sample variationIndependent protein preparations

Additionally, researchers should consider including MT-CO2 variants with known mutations affecting function to provide reference points for interpreting experimental results.

How can researchers optimize the expression and purification of recombinant Lophuromys flavopunctatus MT-CO2?

Optimizing expression and purification requires addressing several challenges specific to membrane proteins like MT-CO2:

  • Expression system selection:

    • Bacterial systems: Fast but may lack proper folding machinery

    • Yeast systems: Better for membrane proteins but lower yield

    • Insect cells: Superior folding but more complex

    • Cell-free systems: Rapid screening but limited scale

  • Solubilization strategy:

    • Detergent screening (mild non-ionic detergents often preferred)

    • Lipid nanodisc incorporation

    • Amphipol stabilization

  • Purification optimization:

    • Initial capture using affinity chromatography (His-tag or specific antibodies)

    • Ion exchange chromatography for charge-based separation

    • Size exclusion chromatography for final polishing and buffer exchange

  • Functional validation:

    • Spectroscopic analysis of copper centers

    • Oxygen consumption assays

    • Reconstitution into proteoliposomes for activity testing

A critical consideration when expressing MT-CO2 is ensuring proper incorporation of the copper centers, which may require supplementation with copper ions and appropriate redox conditions during expression or reconstitution steps.

How should researchers interpret contradictory data in MT-CO2 functional studies?

When faced with contradictory data in MT-CO2 studies, researchers should implement a systematic troubleshooting approach:

  • Assess protein integrity: Verify protein folding, copper center incorporation, and subunit assembly using spectroscopic methods and native gel electrophoresis.

  • Evaluate experimental conditions: Different buffer compositions, temperature, pH, and ionic strength can significantly affect MT-CO2 activity. Systematic variation of these parameters may resolve apparent contradictions.

  • Consider isoform differences: The Yellow-spotted brush-furred rat may express tissue-specific MT-CO2 variants with distinct properties. Researchers should verify the exact isoform being studied and its relevance to the biological question.

  • Apply multiple methodologies: When one technique yields contradictory results, employing orthogonal approaches can help resolve discrepancies. For example, combining spectroscopic, kinetic, and structural analyses provides a more complete picture.

  • Statistical robustness: Ensure sufficient replication (both technical and biological) and appropriate statistical tests to distinguish real effects from experimental variation.

  • Literature context: Compare results with studies on MT-CO2 from other species to identify potential species-specific differences that might explain discrepancies.

What advanced analytical techniques can reveal MT-CO2 functional mechanisms?

Several sophisticated analytical approaches can provide deeper insights into MT-CO2 function:

  • Time-resolved spectroscopy: Captures electron transfer kinetics at microsecond to nanosecond timescales, revealing the sequence of electron movements through the copper centers.

  • Hydrogen/deuterium exchange mass spectrometry: Identifies flexible regions and conformational changes associated with electron transfer, providing insights into dynamic aspects of MT-CO2 function.

  • Single-molecule techniques: FRET and other single-molecule approaches can detect conformational changes and heterogeneity not observable in bulk measurements.

  • Computational approaches: Molecular dynamics simulations and quantum mechanical calculations can model electron transfer pathways and predict effects of mutations or environmental changes.

  • In silico analysis: Comparative genomic approaches examining MT-CO2 sequence conservation across species can identify functionally critical residues and potential adaptations in Lophuromys flavopunctatus.

How might MT-CO2 research contribute to biomanufacturing applications?

Research on recombinant MT-CO2 has potential applications in developing biomanufacturing systems:

  • Space biomanufacturing: MT-CO2 and related cytochrome oxidase components could play roles in carbon dioxide utilization systems for space missions, particularly in closed-loop life support systems .

  • CO2 reduction technologies: The electron transfer capabilities of MT-CO2 could inform the design of bioinspired catalysts for carbon dioxide reduction, contributing to climate change mitigation technologies.

  • Bioreactor design: Insights from MT-CO2 function under varied atmospheric conditions could improve bioreactor design for recombinant protein production, particularly for systems intended to operate with altered gas compositions .

  • Synthetic biology applications: MT-CO2 components could be incorporated into synthetic electron transport chains designed for specific biotechnology applications, such as microbial fuel cells or biosensors.

These applications would require fundamental research addressing protein stability, functional optimization, and integration with other biological or synthetic components.

What are the most promising comparative studies involving Lophuromys flavopunctatus MT-CO2?

Comparative studies represent a valuable approach for understanding the unique properties of Lophuromys flavopunctatus MT-CO2:

  • Evolutionary adaptation studies: Comparing MT-CO2 sequences and functions across species that inhabit different ecological niches could reveal adaptations to specific environmental conditions.

  • Metabolic efficiency comparisons: Investigating whether Lophuromys flavopunctatus MT-CO2 exhibits different electron transfer efficiencies compared to other rodent species could provide insights into metabolic adaptations.

  • Structure-function relationships: Detailed comparison of conserved regions versus variable domains across species can identify critical functional determinants versus adaptable regions.

  • Pathology models: Comparing wild-type MT-CO2 with human disease-associated variants could provide insights into mitochondrial disorders and potential therapeutic approaches.

These comparative approaches would benefit from the collection of physiological data from Lophuromys flavopunctatus to provide context for the molecular findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.