Recombinant Loris tardigradus Melanocyte-stimulating hormone receptor (MC1R)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For specific delivery information, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
MC1R; Melanocyte-stimulating hormone receptor; MSH-R; Melanocortin receptor 1; MC1-R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Loris tardigradus (Slender loris)
Target Names
Target Protein Sequence
MPAQGSQRSLLGSLNSTLMATSSLGLSANQSGPQCLEVSVPDGLFLCLGLVSLVENMLVV AAIAKNRNLHSPMYCFICCLALSDLLVSVSNVLETAVMLLLEAGALAAQATVVQQLDNII DVLVCSSMVSSLCFLGAIAMDRYISIFYALRYHSIVTLSRAQWATAAVWAAGILSSTLFI AYYDHTAVLLCLVVFFLAMLVLMAVLYAHMLTQACQHVQGITRLHKRQHLVQQGFGLKGA ATLTILLGVFLLCWGPFFLHLTLIAVCPQHPTCSCVFKNFKLFLALIICNAIVDPLIYAF RXQELRKTLKEVLLFSW
Uniprot No.

Target Background

Function
Melanocyte-stimulating hormone receptor (MC1R) is a receptor for MSH (alpha, beta, and gamma) and ACTH. Its activity is mediated by G proteins, which activate adenylate cyclase. It plays a crucial role in melanogenesis, the production of eumelanin (black/brown) and phaeomelanin (red/yellow), by regulating cAMP signaling in melanocytes.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of MC1R in Lorisidae, and how does Loris tardigradus MC1R compare to other primates?

MC1R in Lorisidae is under purifying selection (ω = 0.0912), indicating strong evolutionary constraint on this gene. This suggests that changes in MC1R sequence are generally deleterious and removed by natural selection. Within the Lorisidae family, there is a dichotomy between the African subfamily Perodictinae (which includes genera like Perodicticus that are monochromatic and lack venom) and the Asian subfamily Lorisinae (which includes Loris and Nycticebus that show higher contrast variation in coat patterns) .

For researchers investigating Loris tardigradus MC1R, this evolutionary context is crucial to consider. When analyzing sequence data, researchers should compare it with other Lorisidae MC1R sequences to identify conserved regions under strong purifying selection versus regions that might show lineage-specific patterns.

How does MC1R function differ between Loris tardigradus and better-studied primate models?

While specific data on Loris tardigradus MC1R function is limited, studies on other primates suggest that unlike in many mammals, nonsynonymous mutations in primate MC1R are not strongly correlated with coat color but appear more influenced by phylogeny . The exception to this pattern is seen in Leontopithecus rosalia (golden lion tamarin), where MC1R shows a higher dN/dS ratio (0.91) and several substitutions at functionally important sites, potentially explaining its red hair phenotype .

Researchers should approach functional studies of Loris tardigradus MC1R with this context in mind, focusing on both:

  • Conserved signaling mechanisms found across primates

  • Potential Lorisidae-specific adaptations related to their nocturnal lifestyle and unique coat patterns

What are the optimal expression systems for producing recombinant Loris tardigradus MC1R protein?

Recombinant MC1R from primates, including Loris tardigradus, can be expressed in several systems depending on research needs:

  • E. coli expression: Suitable for producing large quantities of protein for structural studies, though may lack post-translational modifications. As seen with other primate MC1R proteins, E. coli systems can yield functional protein when fused with tags (e.g., His-tag) to aid purification .

  • Mammalian cell expression: HEK293 cells provide a more native environment for proper folding and post-translational modifications of MC1R. This system is preferred when studying receptor signaling and interactions with other proteins.

  • Insect cell expression: Baculovirus-infected insect cells offer an intermediate between bacterial and mammalian systems, with better protein folding than bacteria but higher yields than mammalian cells.

The choice depends on experimental goals: structural studies might prioritize E. coli expression, while functional signaling studies would benefit from mammalian expression systems.

What molecular techniques are most effective for studying MC1R polymorphisms in Loris tardigradus populations?

For investigating MC1R polymorphisms in Loris tardigradus populations, researchers should employ a multi-phase approach:

  • Initial sequencing: The complete MC1R locus should be sequenced using Sanger sequencing of PCR products, similar to approaches used in studying MC1R diversity in other species . This enables identification of both common and rare variants.

  • Genotyping strategy: For larger population studies, researchers can design targeted genotyping assays focusing on identified polymorphic sites. PCR-RFLP or custom SNP arrays may be employed for cost-effective screening of multiple samples.

  • Data analysis: Statistical approaches similar to those used in melanoma studies can be adapted, including:

    • Calculation of odds ratios for specific phenotypes associated with variants

    • Classification of variants as "R" (strong) or "r" (weak) based on their predicted functional effects

    • Analysis of linkage disequilibrium patterns to identify signatures of selection

  • Validation: Functional validation of identified variants through in vitro expression and signaling assays is essential to connect genotype to phenotype.

How should researchers design experiments to correlate MC1R variants with coat color patterns in Loris tardigradus?

Designing robust experiments to correlate MC1R variants with coat color patterns requires:

  • Comprehensive phenotyping:

    • Standardized photography under controlled lighting conditions

    • Quantitative measurement of coat coloration using colorimetry or spectrophotometry

    • Detailed mapping of color pattern distributions across body regions

  • Genotype-phenotype correlation:

    • Sample collection from individuals representing the full spectrum of coat color variations

    • MC1R sequencing and identification of variants

    • Statistical analysis similar to approaches used in reptile studies, where strong associations between MC1R polymorphisms and color differences were established

  • Control for population structure:

    • Sequence additional neutral markers (e.g., mitochondrial ND4 gene) to assess and control for population structure

    • Apply methods to test for deviations from neutral expectations at MC1R locus

  • Environmental considerations:

    • Document habitat characteristics of sampled individuals

    • Consider potential selective pressures (e.g., predation, thermoregulation) in different environments

What purification strategies yield the highest activity for recombinant Loris tardigradus MC1R?

Purification of recombinant Loris tardigradus MC1R presents challenges due to its nature as a seven-transmembrane G protein-coupled receptor. Based on approaches with other MC1R proteins, researchers should consider:

  • Detergent screening:

    • Test multiple detergents (e.g., DDM, LMNG, GDN) for optimal solubilization

    • Evaluate detergent effects on protein stability and activity

  • Affinity chromatography:

    • Utilize N-terminal or C-terminal affinity tags (His-tag being common)

    • Consider tandem affinity purification for improved purity

  • Size exclusion chromatography:

    • Critical for removing aggregates and ensuring monodispersity

    • Buffer optimization to maintain receptor stability

  • Activity assessment:

    • Develop ligand binding assays using melanocortin peptides

    • Establish G protein coupling assays to verify functional activity

    • Consider reconstitution into nanodiscs or liposomes for improved stability

Researchers should expect yields of 0.1-1.0 mg/mL after reconstitution from lyophilized powder, with storage in buffer containing 5-50% glycerol at -20°C/-80°C to maintain activity .

How do post-translational modifications affect Loris tardigradus MC1R signaling compared to other primates?

Post-translational modifications (PTMs) likely play crucial roles in regulating Loris tardigradus MC1R function, though species-specific data is limited. A comprehensive investigation should include:

  • Identification of putative PTM sites:

    • Computational prediction based on sequence alignment with well-studied primate MC1Rs

    • Mass spectrometry analysis of recombinant or native receptor

  • Functional characterization:

    • Site-directed mutagenesis of predicted PTM sites

    • Phosphorylation analysis using phospho-specific antibodies

    • Glycosylation analysis through enzymatic deglycosylation and mobility shift assays

  • Signaling impact assessment:

    • cAMP accumulation assays to quantify canonical signaling

    • Calcium mobilization assays for alternative pathways

    • ERK1/2 phosphorylation for MAPK pathway activation

    • β-arrestin recruitment assays for desensitization mechanisms

  • Comparative analysis:

    • Parallel studies with MC1R from multiple primate species, including humans and other Lorisidae

    • Correlation of PTM patterns with ecological and physiological adaptations

This approach would reveal whether unique PTM patterns in Loris tardigradus MC1R contribute to its adaptation to nocturnal lifestyle and specific coat coloration patterns observed in this species.

What insights can structural biology approaches provide about Loris tardigradus MC1R ligand binding and activation?

Advanced structural biology approaches can reveal crucial insights about Loris tardigradus MC1R function:

  • Homology modeling and molecular dynamics:

    • Generate structural models based on recently solved GPCR structures

    • Perform molecular dynamics simulations to identify stable conformations

    • Dock melanocortin peptides and synthetic ligands to predict binding modes

  • Cryo-electron microscopy:

    • Purify recombinant MC1R in detergent micelles or nanodiscs

    • Collect and process cryo-EM data to determine 3D structure

    • Analyze conformational states (inactive, active, intermediate)

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map conformational changes upon ligand binding

    • Identify regions with altered solvent accessibility during activation

    • Compare dynamics between wild-type and variant receptors

  • Cross-linking mass spectrometry:

    • Identify intramolecular contacts stabilizing specific conformations

    • Map intermolecular interactions with signaling partners

Researchers should focus on identifying unique structural features of Loris tardigradus MC1R that may relate to its evolution under purifying selection in nocturnal primates , potentially revealing adaptations specific to the visual ecology of Lorisidae.

How can CRISPR-Cas9 gene editing be optimized to study MC1R function in Loris tardigradus cell models?

CRISPR-Cas9 gene editing offers powerful approaches for studying MC1R function in Loris tardigradus, though ethical considerations limit direct editing in this protected species. Researchers should instead:

  • Develop cell models:

    • Establish primary fibroblast cultures from Loris tardigradus (requiring minimal invasive sampling)

    • Generate induced pluripotent stem cells (iPSCs) and differentiate to melanocytes

    • Create immortalized cell lines when appropriate

  • CRISPR-Cas9 design optimization:

    • Design multiple guide RNAs targeting conserved MC1R regions

    • Test editing efficiency in surrogate primate cell lines

    • Optimize homology-directed repair templates for precise editing

  • Functional validation approaches:

    • Measure melanin production in edited cells

    • Quantify cAMP signaling in response to melanocortin peptides

    • Analyze gene expression changes using RNA-seq

  • Comparative approach:

    • Create parallel edits in cell lines from multiple primate species

    • Introduce specific Loris tardigradus MC1R variants into human melanocytes

    • Swap domains between species to identify functionally divergent regions

This strategy circumvents the ethical limitations of editing endangered primates while still providing valuable insights into MC1R function specific to Loris tardigradus.

What strategies can resolve contradictory data on MC1R function between in vitro and in vivo studies in Lorisidae?

Contradictory results between in vitro and in vivo studies of MC1R function in Lorisidae can be resolved through:

  • Improved in vitro systems:

    • Develop co-expression systems including MC1R signaling partners

    • Establish 3D culture models that better recapitulate tissue architecture

    • Adjust experimental conditions to match physiological parameters

  • Advanced in vivo approaches:

    • Non-invasive sampling methods compatible with endangered status

    • In situ hybridization and immunohistochemistry on archived tissues

    • Ex vivo skin explant cultures for pharmacological manipulation

  • Integrative data analysis:

    • Bayesian statistical approaches to reconcile conflicting datasets

    • Systems biology modeling of melanogenesis pathways

    • Meta-analysis of results across multiple studies and species

  • Cross-validation approaches:

    • Parallel testing in multiple model systems

    • Development of species-specific antibodies and reagents

    • Independent replication by different research groups

Researchers should particularly focus on the purifying selection observed in Lorisidae MC1R (ω = 0.0912) , as this evolutionary constraint may indicate functional requirements not fully captured in simplified in vitro systems.

How can transcriptomic and proteomic approaches enhance our understanding of MC1R signaling networks in Loris tardigradus?

Integrative -omics approaches can provide systems-level insights into MC1R signaling:

  • Comparative transcriptomics:

    • RNA-seq analysis of Loris tardigradus melanocytes with MC1R stimulation/inhibition

    • Identification of species-specific transcriptional responses

    • Analysis of alternatively spliced gene products in the melanogenesis pathway

  • Proteomics strategies:

    • Proximity labeling approaches (BioID, APEX) to map MC1R interactome

    • Phosphoproteomics to characterize signaling cascades

    • Quantitative proteomics to identify differentially expressed proteins

  • Integration with genomic data:

    • Correlation of transcriptomic responses with MC1R genetic variants

    • Analysis of regulatory elements controlling MC1R expression

    • Identification of species-specific regulatory networks

  • Functional validation:

    • siRNA knockdown of key identified pathway components

    • Pharmacological manipulation of novel signaling nodes

    • Development of reporter systems for real-time signaling visualization

This multi-omics approach would reveal how MC1R signaling networks in Loris tardigradus might differ from those in diurnal primates, potentially relating to their nocturnal lifestyle and unique pigmentation patterns.

What are the most sensitive methods for quantifying recombinant Loris tardigradus MC1R ligand binding kinetics?

Advanced biophysical techniques for quantifying MC1R-ligand interactions include:

  • Surface plasmon resonance (SPR):

    • Immobilize purified MC1R on sensor chips

    • Measure real-time association/dissociation kinetics

    • Determine binding constants (ka, kd, KD) for various ligands

  • Isothermal titration calorimetry (ITC):

    • Directly measure thermodynamic parameters of binding

    • No labeling or immobilization required

    • Provides complete thermodynamic profile (ΔH, ΔS, ΔG)

  • Fluorescence-based techniques:

    • Time-resolved FRET using labeled ligands and receptors

    • Fluorescence polarization for solution-phase binding assays

    • Single-molecule FRET to capture conformational dynamics

  • Radioligand binding:

    • Saturation binding with [125I]-labeled MSH peptides

    • Competition binding to determine relative affinities

    • Kinetic binding to measure association/dissociation rates

When working with recombinant Loris tardigradus MC1R, researchers should recognize that protein preparation quality significantly impacts binding measurements. Verification of properly folded protein by circular dichroism spectroscopy is recommended before conducting detailed kinetic analyses .

How can comparative studies of Loris tardigradus MC1R inform our understanding of primate evolution and adaptation?

Comparative studies of Loris tardigradus MC1R provide unique evolutionary insights:

  • Ecological adaptation analysis:

    • Compare MC1R sequence and function between Loris tardigradus and closely related species

    • Correlate molecular changes with habitat preferences and activity patterns

    • Test for signatures of selection in specific lineages

  • Convergent evolution investigation:

    • Identify parallel adaptive changes in distantly related nocturnal primates

    • Compare Lorisidae MC1R evolution with that in New World monkeys showing similar coat patterns

  • Functional divergence mapping:

    • Characterize differences in signaling properties between Lorisidae and other primate MC1R proteins

    • Relate molecular changes to phenotypic differences in coat coloration

    • Identify lineage-specific functional constraints

  • Implications for primate evolution models:

    • Integrate MC1R data with broader phylogenetic analyses

    • Establish timeline for acquisition of specific MC1R variants

    • Correlate MC1R evolution with major adaptive shifts in primate evolution

These approaches would extend our understanding beyond the current knowledge that Lorisidae MC1R is under purifying selection , potentially revealing how specific molecular changes relate to the unique ecology and pigmentation patterns of these nocturnal primates.

What novel experimental approaches could resolve contradictory data on the role of MC1R in Lorisidae coloration patterns?

To resolve contradictory data on MC1R's role in Lorisidae coloration, researchers should consider:

  • Spatial expression mapping:

    • Single-cell RNA-seq of skin samples from differently pigmented body regions

    • Spatial transcriptomics to correlate MC1R expression with color pattern boundaries

    • In situ hybridization with cell-type specific markers

  • Genetic association studies with increased power:

    • Expanded sampling across Lorisidae species with diverse coloration patterns

    • Focus on highly polymorphic regions identified in preliminary studies

    • Application of methods similar to those used in reptile studies where MC1R polymorphisms show strong association with color differences

  • Experimental manipulation in model systems:

    • CRISPR-Cas9 knock-in of Loris tardigradus MC1R variants in mouse melanocytes

    • Ex vivo skin culture systems with viral delivery of MC1R variants

    • Development of Loris tardigradus melanocyte cell lines for direct testing

  • Integration with other pigmentation genes:

    • Analysis of epistatic interactions between MC1R and other melanogenesis genes

    • Whole-genome sequencing to identify novel loci contributing to coloration

    • Pathway analysis integrating multiple genetic contributors

This multi-faceted approach would help determine whether the purifying selection observed in Lorisidae MC1R indicates functional conservation despite phenotypic diversity, or whether coloration patterns in these primates are primarily controlled by other genetic mechanisms.

Table 1: Comparison of Evolutionary Constraints on MC1R Across Primate Taxa

Primate GroupdN/dS RatioSelection PatternColor Pattern ComplexityReference
Lorisidae0.0912PurifyingVariable (high in Lorisinae)
Leontopithecus rosalia0.91Neutral/PositiveHigh (golden/red)
Other non-human primates<0.5PurifyingVariable
HumanVariableMixedLow (regional)

Table 2: Recommended Expression Systems for Recombinant Loris tardigradus MC1R

Expression SystemAdvantagesLimitationsBest Applications
E. coliHigh yield, cost-effective, simple protocolsLimited post-translational modificationsStructural studies, antibody production
Mammalian cells (HEK293)Native-like folding and modificationsLower yield, higher costSignaling studies, drug screening
Insect cellsModerate yield, eukaryotic processingMedium complexityStructural biology, protein-protein interactions
Cell-free systemsRapid production, membrane protein compatibilityLimited scale, higher costInitial screening, directed evolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.