Recombinant Loxodonta africana NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

Shipped with Ice Packs
In Stock

Description

Function in Oxidative Phosphorylation

MT-ND4L is indispensable for:

  • Electron transfer: Facilitates NADH oxidation to FMNH₂, initiating the ETC .

  • Proton pumping: Contributes to the proton gradient across the inner mitochondrial membrane, driving ATP synthase activity .

  • Complex I stability: Forms hydrophobic interactions with other ND subunits (e.g., ND1, ND4) to anchor the complex in the membrane .

Recombinant Production and Applications

Recombinant MT-ND4L proteins are synthesized in heterologous systems (e.g., E. coli) for structural and functional studies.

Example: Human MT-ND4L Recombinant Protein

ParameterSpecificationSource
Expression systemE. coli
TagN-terminal His-tag
Sequence coverageFull-length (1–98 amino acids)
PurityHigh (≥95%)

Note: No specific data exists for Loxodonta africana MT-ND4L recombinant proteins.

Disease Associations

  • Leber Hereditary Optic Neuropathy (LHON): A T10663C mutation (Val65Ala) in human MT-ND4L disrupts Complex I activity, leading to optic nerve degeneration .

  • Metabolic Disorders: Variants linked to obesity, diabetes, and hypertension in humans .

Research Insights from Model Organisms

A study in mice with mitochondrial respiratory chain (mtRC) dysfunction revealed:

  1. Downregulation of mtDNA-encoded genes: mt-Nd4l, mt-Nd3, and mt-Cytb were reduced in cartilage cells, correlating with extracellular matrix destabilization .

  2. ECM remodeling: Increased expression of Mmp10 and Thbs1 in nonarticular chondrocytes under mtRC stress .

Gaps and Future Directions

  1. Species-Specific Data: No studies explicitly address Loxodonta africana MT-ND4L. Comparative genomics or proteomics could reveal conservation/divergence in elephant mitochondrial biology.

  2. Functional Studies: Recombinant Loxodonta africana MT-ND4L would enable:

    • Structural analysis of species-specific residues.

    • Validation of cross-species disease mechanisms (e.g., LHON analogs in elephants).

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All protein shipments are delivered with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please communicate it to us, and we will prioritize development of the specified tag.
Synonyms
MT-ND4L; MTND4L; NADH4L; ND4L; NADH-ubiquinone oxidoreductase chain 4L; NADH dehydrogenase subunit 4L
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-98
Protein Length
full length protein
Species
Loxodonta africana (African elephant)
Target Names
Target Protein Sequence
MPYIYMNITLAFVISLIGTLMYRSHLMSSLLCLEGMMLSLFTLNALLSLNMNFTLSTTVP LILLVFAACEAAVGLALLVMISNTYGLDYVQNLNLLQC
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is MT-ND4L and what is its normal function in cellular metabolism?

MT-ND4L (NADH dehydrogenase 4L) is a protein-coding gene found in mitochondrial DNA that provides instructions for making the NADH dehydrogenase 4L protein, which is a critical component of Complex I (NADH:ubiquinone oxidoreductase) in the electron transport chain . This protein is embedded in the inner mitochondrial membrane where it participates in oxidative phosphorylation, the process by which cells convert energy from food into adenosine triphosphate (ATP) . Within Complex I, MT-ND4L contributes to the first step of electron transport, transferring electrons from NADH to ubiquinone (coenzyme Q) . This electron transfer helps establish the electrochemical gradient across the inner mitochondrial membrane that ultimately drives ATP synthesis, providing the primary energy source for cellular functions .

How does MT-ND4L integrate with other subunits in Complex I of the respiratory chain?

MT-ND4L functions as part of a large multi-subunit enzyme complex (Complex I) that contains multiple mitochondrial-encoded subunits. Complex I in mammals contains seven mitochondrial-encoded subunits: ND1, ND2, ND3, ND4, ND4L, ND5, and ND6 . MT-ND4L interacts directly with several other subunits to maintain the structural and functional integrity of Complex I. Based on structural biology studies, MT-ND4L appears to contribute to the formation of proton-translocation channels within Complex I . The protein contains multiple transmembrane helices that interact with other Complex I components, particularly with ND1, ND2, and ND6 subunits, forming part of the lipid-facing layer of the enzyme complex . These interactions are essential for maintaining the proper conformation of the entry point for ubiquinone and for ensuring efficient proton pumping across the membrane .

What are the key biochemical characteristics of the Loxodonta africana MT-ND4L protein?

The Loxodonta africana (African elephant) MT-ND4L protein functions as a NADH dehydrogenase subunit with the Enzyme Commission number EC 1.6.5.3 . As a hydrophobic membrane protein, it contains multiple transmembrane helices that anchor it within the inner mitochondrial membrane . The protein plays a crucial role in the NADH:ubiquinone oxidoreductase activity of Complex I . When produced as a recombinant protein, it can be expressed in various host systems including E. coli, yeast, baculovirus, or mammalian cells, and typically achieves a purity of >90% when properly isolated . The recombinant form is typically stored in liquid form containing glycerol and demonstrates best stability when stored at -20°C to -80°C for long-term preservation, with working aliquots maintained at 4°C for up to one week .

What purification strategies are most effective for isolating functional MT-ND4L?

Purifying functional MT-ND4L presents significant challenges due to its hydrophobic nature and membrane integration. Based on standard protocols for mitochondrial membrane proteins, an effective purification strategy involves:

  • Cell lysis using gentle detergents (such as n-dodecyl β-D-maltoside or digitonin) that preserve protein structure while solubilizing membrane components

  • Initial purification using affinity chromatography (if a tag was incorporated into the recombinant protein)

  • Secondary purification via ion exchange chromatography

  • Final purification using size exclusion chromatography to achieve >90% purity

Throughout the purification process, maintaining a stable buffer environment with appropriate detergent concentrations is critical for preventing protein aggregation and preserving functionality. The purified protein should be stored in a solution containing glycerol to maintain stability . Quality control using SDS-PAGE, Western blotting, and activity assays should be performed to confirm both purity and functionality of the isolated protein.

How can researchers validate the structural integrity and functionality of purified recombinant MT-ND4L?

Validating both structural integrity and functionality of purified recombinant MT-ND4L requires a multi-faceted approach:

Structural Validation:

  • Circular dichroism (CD) spectroscopy to assess secondary structure content

  • Limited proteolysis to verify proper folding

  • Size exclusion chromatography to confirm monomeric state or appropriate oligomerization

  • Homology protein structure modeling to predict the 3D structure, as has been done for elephant MT-ND4L

Functional Validation:

  • NADH:ubiquinone oxidoreductase activity assays measuring electron transfer rates

  • Reconstitution into liposomes to assess membrane integration

  • Complex I assembly assays when combined with other subunits

  • Oxygen consumption measurements in reconstituted systems

Researchers should remember that since MT-ND4L normally functions as part of Complex I, its activity may be limited when isolated. Therefore, reconstitution experiments with other Complex I components may be necessary for meaningful functional validation .

What evidence exists for adaptive evolution of MT-ND4L in African elephants?

Significant evidence indicates adaptive evolution of MT-ND4L in African elephants, particularly between forest (Loxodonta cyclotis) and savanna (Loxodonta africana) elephant species. Research has identified multiple sites within the MT-ND4L gene that show signatures of positive selection between these closely related species . Phylogenetic analyses confirm deep divergence between forest and savanna elephants, with specific amino acid substitutions in MT-ND4L that appear to be under selective pressure . These substitutions are not randomly distributed but occur at functionally important sites within the protein, particularly at locations that could affect the efficiency of proton pumps within Complex I . The strategic positioning of these substitutions suggests they may confer adaptive advantages related to metabolic efficiency in the different habitats occupied by forest and savanna elephants. This evolutionary pattern indicates that MT-ND4L may play a role in the adaptive divergence of these elephant species by influencing their metabolic capabilities in response to different environmental conditions .

How do amino acid substitutions in MT-ND4L differ between forest and savanna elephants, and what functional implications might these have?

Forest (Loxodonta cyclotis) and savanna (Loxodonta africana) elephants show several significant amino acid substitutions in MT-ND4L that could have important functional implications for energy metabolism. Research has identified specific substitutions at protein-binding sites that likely affect interactions within the oxidative phosphorylation pathway .

Key substitutions include:

PositionSavanna Elephant (L. africana)Forest Elephant (L. cyclotis)Biochemical ChangePotential Functional Impact
ND1, 49IsoleucineValine (in some samples)Both aliphatic, hydrophobicMay affect quinone binding site entry point
ND6, 43IsoleucineValine (in most samples)Similar biochemical propertiesAffects interaction with other subunits in proton-translocation channel
ND5, 20IsoleucineThreonineChange from aliphatic to polarLocated in transmembrane helix, may alter lipid interaction
ND5, 21ThreonineAlanine/Isoleucine (varies)Change in hydrophobicity and polarityLocated in transmembrane helix, may alter protein conformation

What methodological approaches are most effective for analyzing selection pressures on mitochondrial genes like MT-ND4L?

Analyzing selection pressures on mitochondrial genes like MT-ND4L requires a multi-faceted approach that integrates evolutionary analysis with structural biology. Based on successful research strategies, the following methodological approaches are particularly effective:

  • Sequence-based selection analyses:

    • Calculation of dN/dS ratios (non-synonymous to synonymous substitution rates)

    • Site-specific selection tests using maximum likelihood methods

    • Branch-site models to detect selection on specific lineages

    • Bayesian approaches to identify positively selected sites

  • Structural context integration:

    • Homology protein structure modeling to predict 3D conformation

    • Mapping selected sites onto predicted structures

    • Analysis of the biochemical properties of substituted amino acids

    • Evaluation of sites in relation to functional domains and protein interfaces

  • Comparative genomics approaches:

    • Phylogenetic analyses to establish evolutionary relationships

    • Population genetics to assess selection within species

    • Examination of convergent evolution across distantly related taxa

    • Integration of ecological and environmental data with genetic patterns

  • Combined empirical-computational framework:

    • Collection of samples (including non-invasive sampling like dung for endangered species)

    • Generation of complete mitochondrial genome sequences

    • Application of selection analyses to identify sites under positive selection

    • Structural modeling to contextualize identified sites within protein complexes

This integrated approach has proven valuable for studying adaptive evolution in non-model organisms like elephants, where experimental validation may be limited by ethical and practical considerations .

How can homology protein structure modeling enhance our understanding of MT-ND4L function?

Homology protein structure modeling provides crucial insights into MT-ND4L function by predicting its three-dimensional structure based on known structures of homologous proteins. This approach is particularly valuable for membrane proteins like MT-ND4L that are difficult to crystallize for direct structural determination . By generating a structural model, researchers can:

  • Identify the spatial arrangement of transmembrane helices and their orientation within the membrane

  • Locate functionally important residues in three-dimensional space

  • Predict protein-protein interaction surfaces with other Complex I subunits

  • Understand how specific amino acid substitutions might affect protein conformation and function

Research on elephant MT-ND4L has successfully applied homology modeling using bacterial homologs (such as from Thermus thermophilus) as templates to predict the protein's structure . This approach revealed that MT-ND4L contains multiple transmembrane helices that contribute to proton channels and interact with other Complex I subunits . By mapping sites under positive selection onto these structural models, researchers could determine that many selected sites occur at binding interfaces with other subunits or near functionally important regions, providing context for understanding the potential adaptive significance of amino acid substitutions between elephant species .

What role does MT-ND4L play in the proton-pumping mechanism of Complex I?

MT-ND4L serves a critical role in the proton-pumping mechanism of Complex I, particularly in forming part of the proton-translocation channels that drive ATP synthesis. Based on structural and functional studies, MT-ND4L contributes to the formation of one of the four proton-translocation channels in Complex I . The protein contains multiple transmembrane helices that span the inner mitochondrial membrane, with specific regions forming part of the channel structure .

MT-ND4L interacts directly with several other subunits including ND1, ND2, and ND6 to maintain the proper conformation of these channels . These interactions are crucial for coupling electron transfer from NADH to ubiquinone with proton pumping across the membrane. Specific amino acid residues in MT-ND4L contribute to the hydrophilic environment necessary for proton movement, while others maintain the structural integrity of the proton channel .

Amino acid substitutions in MT-ND4L, particularly those occurring at interfaces with other subunits or within channel-forming regions, can potentially alter the efficiency of proton pumping . This mechanistic role explains why mutations in MT-ND4L can lead to mitochondrial disorders like Leber hereditary optic neuropathy, as disruptions to proton pumping would directly impact ATP production .

What is known about mutations in MT-ND4L and their association with human mitochondrial disorders?

Mutations in MT-ND4L have been implicated in several mitochondrial disorders, most notably Leber hereditary optic neuropathy (LHON). The T10663C (Val65Ala) mutation has been identified in several families with LHON . This mutation changes a single amino acid in the NADH dehydrogenase 4L protein, replacing the amino acid valine with alanine at position 65 . While the exact pathophysiological mechanism remains incompletely understood, this mutation likely disrupts the normal function of Complex I in the electron transport chain .

Since MT-ND4L plays a crucial role in the first step of electron transport and contributes to proton pumping across the inner mitochondrial membrane, mutations in this gene can potentially reduce the efficiency of ATP production . In tissues with high energy demands, such as the optic nerve, reduced ATP production can lead to cellular dysfunction and ultimately cell death, explaining the tissue-specific manifestation of certain MT-ND4L mutations .

Although research has primarily focused on LHON, the central role of MT-ND4L in oxidative phosphorylation suggests that mutations in this gene could potentially contribute to other mitochondrial disorders characterized by impaired energy production, particularly those affecting tissues with high metabolic demands .

How can studies of Loxodonta africana MT-ND4L inform our understanding of mitochondrial disease mechanisms?

Studies of Loxodonta africana MT-ND4L provide valuable insights into mitochondrial disease mechanisms through comparative genomics and evolutionary medicine approaches. By examining natural variations in MT-ND4L across elephant species that have adapted to different environments, researchers can identify potentially functional sites in the protein that may also be relevant to human disease .

Several aspects of elephant MT-ND4L research inform disease mechanisms:

  • Natural experiments in adaptation: The amino acid substitutions identified between forest and savanna elephants represent natural experiments in adaptation that can reveal functionally important sites. These sites may overlap with positions where pathogenic mutations occur in humans .

  • Structural context of mutations: Homology modeling of elephant MT-ND4L helps identify the structural context of amino acid substitutions, which can be applied to understand how human mutations might disrupt protein function .

  • Functional consequences of substitutions: By analyzing how substitutions in elephant MT-ND4L potentially affect interactions with other subunits or influence proton channel function, researchers can develop hypotheses about the functional consequences of human disease mutations .

  • Biochemical property changes: Comparing the biochemical properties of substituted amino acids in elephant MT-ND4L (e.g., changes in hydrophobicity, polarity, or size) provides insight into how similar property changes might affect protein function in human mitochondrial disorders .

This comparative approach complements traditional clinical studies by providing evolutionary context for understanding which sites in MT-ND4L are likely to be functionally important and how changes at these sites might contribute to disease mechanisms .

What experimental approaches can link MT-ND4L variations to metabolic phenotypes in model systems?

Investigating the relationship between MT-ND4L variations and metabolic phenotypes requires a multidisciplinary approach combining molecular, cellular, and physiological techniques. The following experimental strategies are particularly effective for establishing these links:

  • Cybrid cell models:

    • Generation of transmitochondrial cybrids by transferring mitochondria with MT-ND4L variants into cells lacking mitochondrial DNA

    • Assessment of respiratory chain function, ATP production, and oxidative stress

    • Measurement of metabolic flux using isotope-labeled substrates

  • CRISPR-based mitochondrial DNA editing:

    • Introduction of specific MT-ND4L variants using emerging mitochondrial genome editing techniques

    • Comparative analysis of isogenic cell lines differing only in MT-ND4L sequence

    • Integration with high-throughput metabolomics and proteomics

  • Recombinant protein functional studies:

    • Expression and purification of recombinant MT-ND4L variants

    • Reconstitution into liposomes or nanodiscs with other Complex I components

    • Direct measurement of electron transfer and proton pumping efficiency

  • Computational and structural biology:

    • Homology modeling to predict structural consequences of variations

    • Molecular dynamics simulations to assess dynamic effects on protein function

    • Integration of selection analysis with structural predictions to prioritize functionally significant variants

  • Metabolic phenotyping:

    • Seahorse extracellular flux analysis to measure oxygen consumption and glycolytic function

    • Mitochondrial membrane potential assays using fluorescent probes

    • Metabolomic profiling to detect downstream metabolic alterations

These approaches can be applied to study both pathogenic mutations associated with human diseases and adaptive variations found between species like forest and savanna elephants, providing insight into how MT-ND4L variations influence metabolic phenotypes .

How can recombinant MT-ND4L be utilized in drug discovery for mitochondrial disorders?

Recombinant MT-ND4L offers several valuable applications in drug discovery for mitochondrial disorders, particularly those involving Complex I dysfunction. As a key component of Complex I, MT-ND4L can serve as a target for developing therapeutics that modulate or restore mitochondrial function. Specific research applications include:

  • High-throughput screening platforms:

    • Development of assay systems using purified recombinant MT-ND4L in reconstituted membrane environments

    • Screening of compound libraries for molecules that stabilize mutant MT-ND4L or enhance its assembly into Complex I

    • Identification of compounds that bypass MT-ND4L dysfunction by facilitating alternative electron transfer pathways

  • Structure-based drug design:

    • Utilization of homology models of MT-ND4L to identify potential binding pockets for small molecules

    • In silico screening and rational design of compounds that could stabilize specific MT-ND4L conformations

    • Development of allosteric modulators that enhance the efficiency of proton pumping in compromised Complex I

  • Protein-protein interaction studies:

    • Screening for compounds that modulate interactions between MT-ND4L and other Complex I subunits

    • Identification of molecules that prevent pathological interactions or promote beneficial ones

    • Development of peptide-based therapeutics that mimic critical interaction domains

  • Biomarker development:

    • Utilization of recombinant MT-ND4L antibodies for developing assays to detect abnormal Complex I assembly

    • Creation of activity-based probes to assess Complex I function in patient samples

    • Development of companion diagnostics for therapeutics targeting Complex I dysfunction

These approaches leverage pure recombinant MT-ND4L protein to develop therapeutic strategies for mitochondrial disorders involving oxidative phosphorylation defects, potentially leading to treatments for conditions like Leber hereditary optic neuropathy associated with MT-ND4L mutations .

What challenges exist in studying protein-protein interactions involving MT-ND4L, and how can they be overcome?

Studying protein-protein interactions involving MT-ND4L presents several significant challenges due to its nature as a small, hydrophobic membrane protein and its integration within the large Complex I. These challenges and potential solutions include:

Challenges:

  • Membrane protein solubility: MT-ND4L is highly hydrophobic and difficult to maintain in solution without appropriate detergents or membrane mimetics.

  • Native conformation preservation: Ensuring that recombinant MT-ND4L maintains its native conformation outside the context of Complex I is challenging.

  • Transient interactions: Some protein-protein interactions involving MT-ND4L may be transient or dependent on specific lipid environments.

  • Size limitations: As a small protein, MT-ND4L offers limited surface area for traditional interaction studies.

  • Co-expression requirements: MT-ND4L may require co-expression with partner proteins for proper folding and stability.

Methodological solutions:

  • Advanced membrane mimetics:

    • Nanodiscs or styrene-maleic acid lipid particles (SMALPs) to maintain MT-ND4L in a near-native lipid environment

    • Bicelles or lipid cubic phases for structural studies of MT-ND4L with interacting partners

  • Proximity labeling approaches:

    • BioID or APEX2 proximity labeling to identify proteins that interact with MT-ND4L in living cells

    • Photo-crosslinking with unnatural amino acids incorporated into MT-ND4L to capture transient interactions

  • Cryo-electron microscopy:

    • Single-particle cryo-EM to visualize MT-ND4L within the intact Complex I structure

    • Subtomogram averaging to study MT-ND4L in its native membrane environment

  • Computational approaches:

    • Molecular dynamics simulations to predict protein-protein interfaces

    • Homology modeling integrated with docking studies to identify potential interaction sites

    • Coevolutionary analysis to predict interacting residues between MT-ND4L and partner proteins

  • Chimeric protein strategies:

    • Creation of fusion proteins to stabilize MT-ND4L and facilitate detection of interactions

    • Split fluorescent or luminescent reporter systems to detect interactions in living cells

By combining these approaches, researchers can overcome the inherent challenges of studying protein-protein interactions involving this small but critical component of the mitochondrial respiratory chain .

How might synthetic biology approaches utilize engineered variants of MT-ND4L for bioenergy applications?

Synthetic biology approaches offer exciting possibilities for utilizing engineered variants of MT-ND4L in bioenergy applications, leveraging the protein's role in electron transport and energy conversion. Based on current understanding of MT-ND4L structure and function, several innovative approaches can be envisioned:

  • Enhanced efficiency Complex I variants:

    • Engineering MT-ND4L variants with amino acid substitutions at key positions identified through evolutionary studies (similar to those between forest and savanna elephants) to create Complex I variants with enhanced electron transfer efficiency

    • Development of MT-ND4L variants with optimized proton pumping capabilities to increase the proton gradient and improve ATP production efficiency

    • Creation of thermostable MT-ND4L variants based on principles learned from extremophiles for use in high-temperature bioenergy applications

  • Modular bioenergy systems:

    • Integration of engineered MT-ND4L into artificial photosynthetic systems to couple light harvesting with NADH production and subsequent electron transfer

    • Development of hybrid systems combining engineered MT-ND4L with non-biological catalysts for improved hydrogen production

    • Creation of minimal respiratory chain complexes incorporating optimized MT-ND4L for specific bioenergy applications

  • Biofuel cell components:

    • Immobilization of engineered MT-ND4L variants within electrode materials to facilitate direct electron transfer in enzymatic biofuel cells

    • Development of MT-ND4L variants with enhanced stability and activity in non-native environments for long-lasting bioenergy devices

    • Creation of designer electron transport chains incorporating modified MT-ND4L for specific substrate utilization in microbial fuel cells

  • Metabolic engineering applications:

    • Integration of optimized MT-ND4L variants into industrial microorganisms to enhance NADH oxidation and improve yield of target metabolites

    • Engineering of MT-ND4L to alter NADH/NAD+ ratios in cells, influencing redox-dependent metabolic pathways

    • Development of switchable MT-ND4L variants that respond to external stimuli for controlled modulation of cellular energetics

These approaches leverage the fundamental role of MT-ND4L in energy transduction while applying lessons from evolutionary studies and structural analyses to create novel bioenergy solutions with improved efficiency, stability, or specificity compared to natural systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.