Recombinant MT-ND6 is a full-length, His-tagged version of the NADH-ubiquinone oxidoreductase chain 6 protein encoded by the mitochondrial genome of the African elephant (Loxodonta africana). As a core subunit of Complex I (NADH dehydrogenase), it facilitates electron transfer from NADH to ubiquinone during oxidative phosphorylation, driving ATP synthesis . The recombinant form retains native structural and functional properties, making it invaluable for biochemical and biomedical research.
Amino Acid Sequence: 175 residues (1-175aa) with the sequence:
MMYIVFIMSVLYVVGFIGFSSKPSPVYGGMSLVVSGGLGCGIIMGSGGSFLGLVVFLVYLGGMMVVFGYTIAMATEEYPETWGSNVVVLGAFLVGLLMEVFMIMWLFSGEHELVGFYFGG LEDLMVLGEGGFEYVREDYSGGASLYSYGFWFLAMAGWMLFVSIFIAIEVTRKRY .
Molecular Weight: ~18–19 kDa (estimated from homologous proteins) .
Post-Translational Modifications: None reported, as it is expressed in E. coli .
| Property | Specification |
|---|---|
| Purity | >90% (SDS-PAGE) |
| Form | Lyophilized powder |
| Storage Buffer | Tris/PBS-based buffer, 6% trehalose, pH 8.0 |
| Reconstitution | 0.1–1.0 mg/mL in sterile water + 5–50% glycerol |
Host: Escherichia coli (prokaryotic system for high-yield production) .
Tag: N-terminal His-tag for affinity chromatography purification .
Enzyme Activity Assays: Study electron transfer kinetics and ubiquinone binding .
Disease Modeling: Investigate mutations linked to mitochondrial disorders like Leber’s hereditary optic neuropathy (LHON) and Leigh syndrome .
Structural Biology: Analyze transmembrane domain organization in Complex I .
Recombinant MT-ND6 from Loxodonta africana shares 85% sequence homology with the rabbit ortholog (Oryctolagus cuniculus), differing primarily in hydrophobic regions critical for membrane integration . This conservation underscores its utility in cross-species mitochondrial studies.
KEGG: lav:808795
STRING: 9785.ENSLAFP00000029502
MT-ND6 serves as a core subunit of mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which catalyzes electron transfer from NADH through the respiratory chain using ubiquinone as an electron acceptor . In Loxodonta africana, MT-ND6 is not only essential for the catalytic activity of Complex I but also plays a critical role in the assembly of the entire complex . Specifically, MT-ND6 is positioned at the junction between the P and Q modules of Complex I and contributes to forming the E-channel, which facilitates electron flow within the complex . Researchers studying Loxodonta africana MT-ND6 should focus on its involvement in adaptation to specific environmental conditions of savanna habitats.
Comparative analyses have identified significant amino acid changes between savanna and forest elephants in the ND6 gene. Specifically, at position 43 of the ND6 protein, Loxodonta africana has valine (V) while most Loxodonta cyclotis samples have isoleucine (I) . Another significant difference appears at position 45, where Loxodonta africana has serine (S) compared to glycine (G) in some Loxodonta cyclotis samples . These amino acid substitutions potentially reflect adaptations to different habitats—savanna versus forest environments—and may alter the efficiency of electron transport and ATP production in these closely related species . When designing experiments to study these differences, researchers should consider including samples from multiple individuals of both species to account for intraspecific variation.
For purifying recombinant Loxodonta africana MT-ND6, researchers typically employ a combination of affinity chromatography and size exclusion techniques adapted for membrane proteins. Since MT-ND6 is a hydrophobic membrane protein with multiple transmembrane domains, purification protocols should include mild detergents such as n-dodecyl β-D-maltoside (DDM) to maintain protein stability and native conformation . Initial purification can be accomplished using Immobilized Metal Affinity Chromatography (IMAC) with a histidine tag, followed by gel filtration to remove aggregates. For functional studies, reconstitution into nanodiscs or liposomes may be necessary to preserve the protein's activity. Quality control steps should include Western blotting using antibodies similar to those developed for human MT-ND6, which have demonstrated cross-reactivity with other mammalian species .
The influence of specific amino acid changes in Loxodonta africana MT-ND6 on Complex I assembly and function can be investigated through site-directed mutagenesis and comparative functional assays. Molecular dynamics simulation approaches similar to those used in studying truncated ND6 forms can provide insights into how specific residues affect protein stability and interactions . Research indicates that conformational changes in ND6 can significantly impact interaction with other Complex I subunits, affecting both assembly and electron transport efficiency .
When investigating these effects, researchers should focus on the transmembrane regions where most significant amino acid differences between elephant species have been detected. For instance, the notable amino acid differences at positions 43 and 45 likely affect hydrophobic interactions within the membrane domain . Functional studies should include measurements of NADH:ubiquinone oxidoreductase activity, ROS production levels, and proton pumping efficiency in reconstituted systems or cellular models expressing wild-type versus mutant forms of Loxodonta africana MT-ND6.
Evidence suggests that positive selection acting on MT-ND6 and other Complex I genes has contributed to metabolic adaptations in Loxodonta africana to savanna environments . To investigate this phenomenon, researchers should employ an integrative approach combining population genetics, biochemical analyses, and ecological studies. Comparative analyses of energy metabolism efficiency between forest and savanna elephants under different temperature and activity conditions could reveal functional consequences of these genetic adaptations .
Research protocols should include:
Measurement of electron transport chain efficiency under varying temperature conditions
Assessment of heat dissipation during cellular respiration
Quantification of ATP production rates in cells expressing Loxodonta africana versus Loxodonta cyclotis MT-ND6
Analysis of ROS production under stress conditions
These functional differences may explain how savanna elephants have adapted to environments with higher ambient temperatures and more open habitats compared to their forest counterparts, requiring potentially different energetic optimizations .
CRISPR-Cas9 gene editing offers powerful approaches for studying MT-ND6 function through conditional knockout systems and precise genetic modifications. Since direct editing of mitochondrial DNA remains challenging, researchers can utilize the "GeneSwap" approach developed for studying mtDNA replication proteins . This method involves creating conditional knockouts of the nuclear-encoded version of the protein while simultaneously expressing recombinant versions with specific modifications .
For studying Loxodonta africana MT-ND6:
First establish cell lines with inducible knockout of endogenous ND6
Create expression constructs containing wild-type or mutant Loxodonta africana MT-ND6
Express these constructs in the knockout background
Measure Complex I assembly, stability, and function
This approach allows for identification of amino acid substitutions that are conditionally permissive for Complex I function and has been successfully applied to other mitochondrial proteins . The technique is particularly valuable for studying species-specific adaptations in mitochondrial genes like those observed between different elephant species.
Expressing functional recombinant Loxodonta africana MT-ND6 in bacterial systems presents significant challenges due to its hydrophobicity and multiple transmembrane domains. The optimal approach involves using specialized E. coli strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), combined with tightly controlled induction systems. The protocol should include:
Gene optimization for bacterial codon usage while maintaining critical functional residues
Fusion with solubility tags (such as MBP or SUMO) at the N-terminus
Low-temperature induction (16-18°C) with reduced IPTG concentrations (0.1-0.2 mM)
Supplementation with specific lipids to facilitate proper membrane insertion
Gentle extraction using mild detergents like DDM or Digitonin
Expression levels should be monitored using Western blotting with antibodies targeting either the fusion tag or specific regions of MT-ND6 . For functional studies, it may be necessary to co-express multiple Complex I subunits simultaneously to facilitate proper folding and assembly. Researchers should verify protein functionality through NADH oxidation assays adapted for recombinant systems.
To effectively compare functional properties of MT-ND6 between elephant species, researchers should employ a multi-tiered experimental approach:
Sequence-based analysis: Begin with comprehensive sequence alignment of MT-ND6 from multiple individuals of both species to identify all variable sites . The table below summarizes key amino acid differences identified in previous research:
| Complex | Gene/Position | Loxodonta africana | Loxodonta cyclotis samples |
|---|---|---|---|
| I | ND6, 43 | V | V, V, I |
| I | ND6, 45 | S | S, S, S |
Structural modeling: Perform homology modeling based on available bacterial Complex I structures, focusing on the transmembrane domain containing MT-ND6 .
Recombinant protein studies: Express both variants in identical systems, either bacterial or mammalian cells with ND6 knockouts.
Functional assays: Compare:
Complex I assembly efficiency
NADH:ubiquinone oxidoreductase activity
Proton pumping efficiency
ROS production under various conditions
Thermal stability profiles
Cellular physiology: Assess differences in:
Mitochondrial membrane potential
ATP production rates under different temperature conditions
Cellular response to oxidative stress
This comprehensive approach allows for detailed characterization of functional differences related to species-specific adaptations in these closely related elephant species .
When conducting molecular dynamics simulations of Loxodonta africana MT-ND6, researchers should consider several critical methodological factors:
Structure preparation: Since no crystal structure of elephant MT-ND6 exists, begin with homology modeling using the closest available structures, such as mammalian Complex I structures (e.g., bovine) or bacterial homologs as templates . For Loxodonta africana specifically, include species-specific amino acid variations at positions 43, 45, and other variable sites .
Simulation environment: MT-ND6 is a membrane protein, requiring a lipid bilayer environment for realistic simulations. Use a POPC bilayer with physiologically relevant composition and incorporate the entire protein or at minimum the transmembrane domain with adjacent subunits to maintain native contacts .
Simulation parameters: Follow established protocols similar to those used in previous ND6 studies:
Use GROMACS with AMBER99SB force field
Immerse proteins in TIP3P cubic water box with at least 1 nm distance between protein and box edge
Perform energy minimization using steepest descent (maximum 50,000 steps)
Equilibrate in NVT ensemble (100 ps with modified Berendsen thermostat at 300K)
Follow with NPT equilibration (100 ps using Parrinello-Rahman barostat at 1 atm)
Analysis metrics: Analyze the following parameters to characterize protein behavior:
These approaches will provide insights into how species-specific variations influence protein dynamics and potential functional differences between elephant species.
When faced with conflicting functional data regarding Loxodonta africana MT-ND6, researchers should employ a systematic approach to interpretation:
Validate experimental conditions: Examine differences in experimental setup including expression systems, buffer compositions, temperature, and pH that might explain discrepancies . Minor variations in conditions can significantly affect membrane protein behavior.
Consider post-translational modifications: Verify whether different levels of phosphorylation, acetylation, or other modifications might exist between experimental systems, as these can substantially affect Complex I function.
Evaluate protein-lipid interactions: The lipid environment critically influences membrane protein function; therefore, differences in lipid composition between experiments may explain conflicting results.
Assess heteroplasmy effects: If using mitochondria from tissue samples, consider that varying levels of wild-type versus variant MT-ND6 might be present, similar to heteroplasmy effects observed in disease models .
Apply statistical rigor: Use appropriate statistical tests for comparing datasets, considering both biological and technical replicates. The student's t-test may be appropriate for comparing two groups, with p-values less than 0.05 considered significant .
Integrate multiple analytical approaches: Combine functional assays with structural studies and molecular dynamics simulations to develop a comprehensive understanding of how specific variations influence function .
Consider evolutionary context: Interpret data within the framework of selective pressures that have shaped elephant species adaptations to their respective environments .
By systematically addressing these factors, researchers can better reconcile seemingly contradictory results and develop a more nuanced understanding of MT-ND6 function.
Resolving discrepancies between computational predictions and experimental outcomes for MT-ND6 mutants requires a multi-faceted approach:
Refine computational models: Improve homology models by incorporating additional structural constraints from related proteins or using multiple templates. For Loxodonta africana MT-ND6, compare models generated from different templates including mammalian and bacterial Complex I structures .
Validate simulation parameters: Ensure that force fields and simulation conditions adequately represent the membrane environment. Consider using multiple force fields to assess prediction robustness.
Extend simulation timescales: Many conformational changes occur on longer timescales than typically simulated. Extending simulations to microseconds or employing enhanced sampling techniques can capture more relevant conformational dynamics .
Implement iterative refinement: Use experimental results to refine computational models, then generate new predictions for experimental testing, creating a feedback loop that improves both approaches.
Consider protein-protein interactions: MT-ND6 functions within the larger Complex I; therefore, simulations of the isolated subunit may miss critical interactions. When possible, simulate MT-ND6 within its native complex environment .
Examine experimental limitations: Assess whether experimental systems fully recapitulate the native environment of MT-ND6, particularly regarding lipid composition and interactions with other Complex I subunits.
Develop targeted validation experiments: Design experiments specifically aimed at testing computational predictions about particular residues or structural elements, such as site-directed mutagenesis of predicted key residues.
This integrated approach allows for progressive refinement of both computational models and experimental systems, ultimately leading to more accurate understanding of MT-ND6 structure-function relationships.
Studying Loxodonta africana MT-ND6 provides unique insights into mitochondrial adaptations to environmental stressors due to the species' evolution in challenging savanna environments. Several research directions are particularly promising:
Thermal adaptation: Savanna elephants experience wider temperature fluctuations than forest elephants. Investigating how MT-ND6 variations influence Complex I thermostability and function across temperature ranges can reveal mechanisms of thermal adaptation .
Energy efficiency trade-offs: The amino acid differences in MT-ND6 between elephant species may represent adaptations that balance ATP production efficiency against heat generation, which would be advantageous in different environmental contexts .
Oxidative stress management: Comparing ROS production and management between Loxodonta africana and Loxodonta cyclotis MT-ND6 variants under various stress conditions could reveal mechanisms for mitigating oxidative damage.
Metabolic flexibility: Research into how MT-ND6 variations affect the ability to switch between metabolic substrates could explain adaptations to seasonal food availability differences between forest and savanna habitats.
Drought adaptation: Savanna elephants regularly experience water scarcity. Studying how MT-ND6 variations might influence water retention in cellular respiration could provide insights into drought adaptation mechanisms.
These research directions not only advance our understanding of elephant biology but also provide broader insights into how mitochondrial genes adapt to environmental pressures, with potential applications to conservation biology and evolutionary studies .
Research on Loxodonta africana MT-ND6 offers valuable insights into nuclear-mitochondrial co-adaptation, a crucial aspect of eukaryotic evolution:
Mitonuclear compatibility: Complex I contains both mitochondrial-encoded subunits (including MT-ND6) and nuclear-encoded components. Studying how species-specific variations in MT-ND6 interact with nuclear-encoded subunits can reveal mechanisms ensuring mitonuclear compatibility .
Subspecies differentiation: The genetic differences in MT-ND6 between Loxodonta africana and Loxodonta cyclotis represent evolutionary divergence that may require co-evolved nuclear factors . This system provides an excellent model for studying how mitonuclear co-adaptation influences speciation.
Methodological approaches: Techniques similar to the GeneSwap approach developed for studying mtDNA replication proteins can be adapted to investigate mitonuclear interactions involving MT-ND6 . This methodology allows for controlled manipulation of both mitochondrial and nuclear components.
Selective pressures: The evidence of positive selection on MT-ND6 in elephants suggests adaptation to different environments . Investigating whether corresponding selection has occurred in nuclear-encoded Complex I subunits would illuminate co-evolutionary processes.
Functional consequences: Research on how MT-ND6 variants interact with species-specific nuclear backgrounds could explain functional differences in energy metabolism between elephant species, potentially revealing mechanisms of local adaptation.
This research area has broader implications for understanding hybrid incompatibility, conservation genetics, and the evolutionary constraints on mitochondrial function across species.