Recombinant Loxodonta africana Suppressor of tumorigenicity 7 protein (ST7)

Shipped with Ice Packs
In Stock

Description

Introduction

The Suppressor of Tumorigenicity 7 (ST7) protein, in humans, is encoded by the ST7 gene . The ST7 gene maps to a critical region and is also known as RAY1 or HELG . ST7 is considered a candidate tumor-suppressor gene . The Loxodonta africana variant of ST7 is found in the African elephant .

Discovery and Background

In 1997, McCormick and colleagues identified ST7 as a novel putative tumor suppressor gene. The ST7 protein exhibits transmembrane receptor characteristics . ST7 is a member of the low-density lipoprotein receptor (LDLR) superfamily and is now referred to as LRP12 . Proteins in this superfamily participate in endocytosis and signal transduction .

Gene and Protein Characteristics

The human ST7 gene is located on chromosome 7q31 . The protein encoded by ST7 contains functional motifs that suggest a role in endocytosis and signal transduction . The cytoplasmic domain of ST7 interacts with proteins involved in signal transduction and endocytosis, such as receptor for activated protein C kinase 1 (RACK1), muscle integrin binding protein (MIBP), and SMAD anchor for receptor activation (SARA) . The Loxodonta africana ST7 protein consists of 585 amino acids .

ST7 Mutations and Polymorphisms

Mutation TypeLocationEffect
G to A substitutionCodon 143 in exon 5Amino acid change from Ala to Thr
Single-nucleotide polymorphisms (SNPs)Introns 8, 10, 11, and 15No correlation with clinicopathological data

Research Findings

Research has investigated the frequency of ST7 gene mutations in various cancers. One study examined 48 colorectal, 48 gastric, and 48 hepatocellular carcinomas and found somatic mutations in only three cases . This suggests that ST7 mutations are rare in these primary cancers .

Conflicting results exist regarding the frequency of ST7 mutations in cancer. Some suggest that discrepancies may arise from the use of selected specimens, PCR artifacts, or the effects of culture passages .

Interactions

ST7 interacts with 378 different proteins . There are 426 interactions and 15 PTM sites .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ST7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Loxodonta africana (African elephant)
Target Names
ST7
Target Protein Sequence
MAEAGTGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHMRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELDIPPAPQSQHFQN
Uniprot No.

Target Background

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ST7 protein and what is its role in tumor suppression?

ST7 (Suppression of Tumorigenicity 7) is a tumor suppressor gene/protein that plays a critical role in cancer prevention. In humans, ST7 is located on chromosome 7q31, a region frequently exhibiting loss of heterozygosity (LOH) in various neoplasias. The protein functions as a type I transmembrane protein belonging to the LDLR superfamily and is also designated as LRP12 .

Molecularly, ST7 exerts its tumor-suppressive effects through several mechanisms:

  • Abrogation of in vivo tumorigenicity without affecting in vitro cell proliferation

  • Modulation of extracellular matrix molecule expression involved in remodeling

  • Possible regulation of apoptotic responses to DNA damage

Studies have demonstrated that introduction of ST7 cDNA into prostate cancer-derived cell lines (PC3) inhibited their tumorigenicity in vivo, providing direct evidence of its tumor suppressor function .

Why is studying ST7 in Loxodonta africana (African elephant) particularly significant?

Studying ST7 in African elephants is significant due to the "Peto's paradox" phenomenon – the observation that large, long-lived animals like elephants don't develop cancer at rates proportional to their body size and lifespan. Key reasons include:

  • Elephants have evolved enhanced cancer protection mechanisms through pervasive duplication of tumor suppressor genes, including ST7

  • African elephants demonstrate remarkably low cancer rates despite having approximately 100 times more cells than humans

  • Elephant cells show heightened sensitivity to DNA damage and induce apoptosis at lower doses of DNA-damaging agents compared to human cells

  • Understanding these mechanisms may provide insights for human cancer prevention and treatment

Research has shown that several Afrotherian lineages, particularly Proboscideans (including elephants), exhibit reduced intrinsic cancer risk coincident with duplication of tumor suppressor genes like ST7 .

What methods are recommended for characterizing recombinant ST7 protein function?

Effective characterization of recombinant ST7 protein function involves multiple approaches:

  • Binding Assays: When immobilized at 0.5 μg/mL, rhST7 demonstrates binding with rhLRPAP at concentrations of approximately 0.6-3 μg/mL, providing a quantifiable measure of interaction

  • Cell-based Functional Assays:

    • Apoptosis assays using ApoTox-Glo to assess ST7's role in programmed cell death

    • Cell cycle analysis to determine effects on proliferation

    • DNA damage response evaluation using mitomycin C as a DNA-damaging agent

  • In vivo Tumorigenicity Assays:

    • Xenograft models comparing tumor growth with and without ST7 expression

    • Assessment of tumor volume, invasiveness, and metastatic potential

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation to identify binding partners

    • Surface plasmon resonance (SPR) for quantitative binding kinetics

    • Yeast two-hybrid screening to identify novel interactors

For optimal results, reconstitute lyophilized ST7 protein at 200 μg/mL in PBS and avoid repeated freeze-thaw cycles to maintain activity .

How should researchers approach experimental design when studying ST7's tumor suppressive effects?

When designing experiments to study ST7's tumor suppressive effects, researchers should consider:

  • Control Selection:

    • Use matched cell lines with and without ST7 expression

    • Include multiple cancer types to assess tissue-specific effects

    • Compare wild-type ST7 with mutant variants identified in tumors

  • Endpoint Selection:

    • Primary endpoints: tumor growth inhibition, apoptosis induction, cell cycle arrest

    • Secondary endpoints: gene expression changes, signaling pathway modulation

    • Exploratory endpoints: metastatic potential, immune cell recruitment

  • Validation Strategies:

    • Confirm findings across multiple cell lines and model systems

    • Use both gain-of-function and loss-of-function approaches

    • Validate key findings in primary patient samples when possible

When assessing apoptotic responses, researchers should employ multiplexed measurements of apoptosis, necrosis, and cell cycle arrest using assays like ApoTox-Glo, as demonstrated in comparative studies with elephant and human cells .

How does elephant ST7 differ from human ST7 at the molecular and functional levels?

Comparative analysis of elephant and human ST7 reveals important differences:

FeatureElephant ST7Human ST7Significance
Gene copy numberMultiple duplicationsSingle copyEnhanced tumor suppression in elephants
Apoptotic responseInduced at lower DNA damage thresholdHigher threshold for responseIncreased cancer resistance in elephants
Tissue expressionWidespread expressionUbiquitous but variable levelsSystemic cancer protection
Protein structurePartial structural variation859 amino acids including signal sequence, ECD, transmembrane domain, cytoplasmic domainFunctional adaptations may exist in elephant version

Functionally, elephant cells (including those expressing ST7) demonstrate heightened sensitivity to DNA damage, with a greater apoptotic response effect size than human cells when exposed to DNA-damaging agents like mitomycin C. This suggests that evolutionary changes in ST7 and related tumor suppressors contribute to the enhanced cancer resistance observed in elephants .

What evolutionary patterns explain ST7 duplication in elephants, and what are the implications for cancer biology?

The evolutionary patterns of ST7 duplication in elephants reveal important insights:

These evolutionary patterns suggest that duplication of tumor suppressor genes like ST7 was a key mechanism that facilitated the evolution of increased body size by compensating for inherently higher cancer risk in larger animals .

How can recombinant ST7 protein be optimally utilized in cancer research models?

Optimal utilization of recombinant ST7 protein in cancer research includes:

  • Reconstitution and Storage Protocols:

    • Reconstitute lyophilized protein at 200 μg/mL in PBS

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles to maintain protein functionality

  • Experimental Applications:

    • Pathway analysis studies to identify downstream effectors

    • Protein-protein interaction screens to identify binding partners

    • Structure-function analyses to determine critical domains

    • Comparative studies between human and elephant ST7 to identify cancer-resistance mechanisms

  • Advanced Research Models:

    • CRISPR/Cas9-mediated gene editing to recreate elephant ST7 duplications in human cells

    • Patient-derived xenografts to study ST7 effects in clinically relevant models

    • 3D organoid cultures to assess effects in tissue-like environments

    • Synthetic biology approaches to engineer enhanced ST7 activity

  • Integrative Analysis:

    • Combine proteomic, transcriptomic, and functional assays to comprehensively map ST7 activity

    • Use computational modeling to predict ST7 interaction networks

    • Apply systems biology approaches to understand ST7 in the context of broader tumor suppressor networks

What technical challenges exist in studying ST7 duplications, and how can researchers overcome them?

Research on ST7 duplications presents several technical challenges:

  • Sequence Homology Complications:

    • Challenge: Highly similar duplicate sequences can complicate PCR amplification, sequencing, and data analysis

    • Solution: Design primers in divergent regions, use long-read sequencing technologies, and apply specialized bioinformatic tools for paralog-specific analysis

  • Expression Analysis Difficulties:

    • Challenge: Standard methods may not distinguish between expression of different gene copies

    • Solution: Develop paralog-specific qPCR assays, use RNA-seq with computational disambiguation of reads, and consider single-cell approaches to detect heterogeneity

  • Functional Redundancy Assessment:

    • Challenge: Determining the unique functional contribution of each duplicate

    • Solution: Selective CRISPR knockout of specific paralogs, paralog-specific knockdown using carefully designed siRNAs, and rescue experiments with individual paralogs

  • Evolutionary Analysis Complexity:

    • Challenge: Determining the timing and selective pressures of duplication events

    • Solution: Apply robust phylogenetic methods, use maximum likelihood-based ancestral state reconstruction (ASR) as implemented in IQ-TREE2, and employ the hypergeometric test to identify enriched pathways

  • Model System Limitations:

    • Challenge: Conventional model organisms lack ST7 duplications seen in elephants

    • Solution: Consider gene editing to introduce elephant-specific duplications, develop elephant cell culture systems, or use comparative systems with naturally varying ST7 copy numbers

Through what molecular pathways does ST7 exert its tumor suppressive effects?

ST7 exerts its tumor suppressive effects through multiple molecular pathways:

  • Apoptosis Regulation:

    • ST7 may enhance sensitivity to DNA damage-induced apoptosis

    • In elephant cells, this manifests as heightened sensitivity to mitomycin C, triggering programmed cell death at lower doses than in human cells

    • This mechanism may involve interaction with core apoptotic machinery including caspases

  • Cell Cycle Control:

    • ST7 likely influences cell cycle progression and checkpoint activation

    • While not affecting in vitro proliferation in some contexts, it may modify cell cycle responses to stress and damage

  • Extracellular Matrix Modulation:

    • Expression of ST7 is associated with downregulation of extracellular matrix molecules involved in remodeling, including:

      • SPARC (Secreted Protein Acidic and Rich in Cysteine)

      • IGFBP5 (Insulin-like Growth Factor Binding Protein 5)

      • Matrix metalloproteinases

    • These changes may reduce invasive potential and metastatic capability

  • Signaling Pathway Interactions:

    • As a member of the LDLR superfamily, ST7/LRP12 likely influences cell signaling

    • May interact with pathways including:

      • Wnt signaling (suggested by interaction with LRP proteins)

      • Growth factor signaling

      • Cell adhesion signaling networks

The protein structure of ST7 provides clues to its function, containing domains including CUB domains, LDLR class A domains, a transmembrane domain, and a cytoplasmic domain with motifs implicated in endocytosis and signal transduction .

How does gene duplication enhance ST7's tumor suppressive capacity in elephants?

Gene duplication enhances ST7's tumor suppressive capacity through several mechanisms:

The evolutionary pattern suggests that natural selection favored these duplications as a mechanism to overcome the increased cancer risk associated with larger body sizes and longer lifespans in elephants.

What are the best practices for storage and handling of recombinant ST7 protein?

Best practices for storage and handling of recombinant ST7 protein include:

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • For recombinant human ST7, a specific recommendation is to reconstitute at 200 μg/mL in PBS

  • Storage Conditions:

    • For short-term storage (up to one week), store working aliquots at 4°C

    • For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C

    • Use a manual defrost freezer to avoid temperature fluctuations

    • The shelf life of liquid form is typically 6 months at -20°C/-80°C

    • The shelf life of lyophilized form is typically 12 months at -20°C/-80°C

  • Handling Precautions:

    • Avoid repeated freeze-thaw cycles as they can significantly reduce protein activity

    • Minimize exposure to room temperature when possible

    • Handle protein solutions with low-binding pipette tips and tubes

    • When aliquoting, prepare single-use volumes to avoid repeated thawing

  • Quality Control Measures:

    • Verify protein purity (>85% by SDS-PAGE is typically acceptable)

    • Confirm activity through functional assays before experimental use

    • Consider including positive controls in experiments to validate protein activity

What genome analysis approaches are most effective for studying ST7 duplications across species?

Effective genome analysis approaches for studying ST7 duplications include:

These methods have successfully revealed that duplication of tumor suppressor genes, including ST7, was pervasive in Afrotherian genomes and coincided with the evolution of increased body size and reduced cancer risk.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.