Recombinant Lumbricus terrestris ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Functional Role in ATP Synthase

ATP6 contributes to the F₀ sector of ATP synthase, which works with the F₁ domain to synthesize ATP via proton gradient-driven rotation. Key mechanisms include:

  • Proton Channel Formation: ATP6 interacts with the c-ring to enable proton flow across the inner mitochondrial membrane .

  • Energy Conversion: Proton movement induces conformational changes in the F₁ domain, catalyzing ADP phosphorylation .

  • Assembly Stability: Subunit a (ATP6) stabilizes ATP synthase dimers and oligomers, critical for cristae formation in mitochondria .

In L. terrestris, nuclear-encoded ATP6 retains conserved transmembrane domains but lacks one ancestral domain, possibly aiding mitochondrial import .

Functional Studies

  • Yeast Models: Mutations in homologous ATP6 (e.g., yeast Atp6p) disrupt ATP synthase assembly, reducing ATP synthesis by 20–30% . These findings highlight the structural sensitivity of ATP6.

  • Evolutionary Insights: Nuclear transfer of ATP6 in L. terrestris and other species (e.g., Mnemiopsis leidyi) provides a model for studying mitochondrial protein import mechanisms .

Biotechnological Applications

  • Enzyme Engineering: Recombinant ATP6 enables studies on ATP synthase assembly and proton channel dynamics .

  • Disease Research: Although L. terrestris ATP6 is not directly linked to human diseases, its structural conservation aids in modeling mitochondrial disorders like Leigh syndrome .

Comparative Analysis with Other Species

FeatureLumbricus terrestris ATP6Human MT-ATP6
Genomic LocationNuclear genome Mitochondrial genome
Introns3 introns in coding sequence None (mitochondrially encoded)
Targeting SignalN-terminal presequence Absent (directly synthesized in mitochondria)

Challenges and Future Directions

  • Structural Resolution: High-resolution structures of L. terrestris ATP6 are lacking, limiting mechanistic insights.

  • Functional Redundancy: The role of ATP6’s missing transmembrane domain in proton translocation remains unclear .

  • Biomedical Relevance: Further studies could explore ATP6’s potential as a therapeutic target for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Lumbricus terrestris (Common earthworm)
Target Names
ATP6
Target Protein Sequence
MMPDIFSSFDPYMFNTLFPLNSLFLVTNTAIILMIQSSFWVLNARTSAFKSPVNDTIFTQ LSRTSTTHLKGLSTPLSTIFFMLVMINLMGLIPYMFSTSSHLVFTLSLGFPIWLSLMIST FAHSPKKSTAHFLPDGAPDWLNPFLVLIETTSVFVRPLTLSFRLAANMSAGHIVLSLMGI YCAAAWFSSVSSTALLILTAIGYILFEVAICLIQAYIFCLLLSLYSDDHAH
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, a gradient generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembraneous catalytic core F1 and the membrane proton channel F0, connected by a central and a peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. A key component of the proton channel, this subunit likely plays a direct role in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of ATP synthase subunit a in Lumbricus terrestris?

ATP synthase subunit a (ATP6) in Lumbricus terrestris is a critical component of the mitochondrial F-type ATP synthase complex. The protein consists of 231 amino acids with a predominantly hydrophobic sequence characteristic of membrane-embedded proteins. The amino acid sequence (MMPDIFSSFDPYMFNTLFPLNSLFLVTNTAIILMIQSSFWVLNARTSAFKSPVNDTIFTQLSRTSTTTHLKGLSTPLSTIFFMLVMINLMGLIPYMFSTSSHLLVFTLSLGFPIWLSLMISTFAHSPKKSTAHFLPDGAPDWLNPFLVLIETTSVFVRPLTLSFRLAANMSAGHIVLSLMGIYCAAAWFSSVSSTALLILTAIGYILFEVAICLIQAYIFCLLLSLYSDDHAH) contains multiple transmembrane domains that form proton-conducting channels within the membrane-embedded F0 portion of ATP synthase .

Functionally, subunit a works in concert with the c-ring to facilitate proton translocation across the membrane, which drives the rotational movement that powers ATP synthesis. The protein contains the critical proton half-channels that direct protons to and from the c-ring binding sites, creating the mechanical force needed for ATP production.

How does Lumbricus terrestris ATP6 compare structurally to ATP6 in other organisms?

While the specific comparative analysis of Lumbricus terrestris ATP6 with other organisms isn't detailed in the available literature, research on ATP synthase across species indicates considerable conservation of function despite sequence variations. ATP synthase subunit a maintains similar structural topology across metazoan lineages, with conserved transmembrane helices that interact with the c-ring to form the proton pathway.

The ATP6 subunit in Lumbricus terrestris (UniProt: Q34946) likely shares functional domains with other metazoans while exhibiting species-specific sequence variations that may reflect evolutionary adaptations to different metabolic requirements or environmental conditions . In contrast to the substantial research conducted on c-subunit stoichiometry variations across species (particularly in photosynthetic organisms with c14 rings versus bacterial c10 or mitochondrial c8 configurations), comparable detailed analyses for subunit a variations are less represented in current literature .

What are the expression patterns of ATP6 in different tissues of Lumbricus terrestris?

To investigate tissue-specific expression patterns, researchers could employ techniques similar to those used in C. elegans studies, including single-cell RNA sequencing methodologies. Such approaches would allow mapping of expression patterns at cellular resolution across the entire organism . This represents an opportunity for future research to characterize tissue-specific adaptations of energy metabolism in this important model organism.

What are the optimal conditions for storage and handling of recombinant Lumbricus terrestris ATP6?

Based on established protocols for recombinant ATP6, the following storage and handling conditions are recommended:

  • Short-term storage: Maintain the protein at 4°C for up to one week in working aliquots to minimize freeze-thaw cycles.

  • Long-term storage: Store at -20°C, and for extended preservation, -80°C is recommended.

  • Storage buffer: The optimal buffer consists of a Tris-based solution with 50% glycerol, specifically formulated to maintain protein stability and prevent aggregation .

  • Handling precautions: Repeated freeze-thaw cycles should be strictly avoided as they significantly reduce protein activity. It is advisable to prepare small working aliquots during initial thawing.

  • Protein concentration: Recombinant ATP6 is typically supplied at concentrations suitable for experimental applications (standard quantity: 50 μg), though other quantities may be available for specific experimental needs .

What methods are most effective for studying protein-protein interactions involving ATP6?

Several methodologies can be applied to investigate protein-protein interactions involving ATP6:

  • Co-immunoprecipitation (Co-IP): This approach can identify native interactions between ATP6 and other subunits of the ATP synthase complex. Antibodies specific to ATP6 or potential interacting partners can be used to pull down protein complexes for subsequent analysis.

  • Crosslinking coupled with mass spectrometry: This technique involves chemical crosslinking of proteins in close proximity followed by mass spectrometric analysis, providing spatial information about interacting domains.

  • Yeast two-hybrid screening: While challenging for membrane proteins like ATP6, modified membrane yeast two-hybrid systems can identify potential interactors.

  • Proximity labeling approaches: Methods such as BioID or APEX2 can identify proteins in close proximity to ATP6 in vivo.

  • Structural biology techniques: Cryo-electron microscopy has proven highly effective for studying ATP synthase complexes and could reveal detailed interaction interfaces involving ATP6.

For functional validation of interactions, researchers could employ techniques similar to those used in whole-organism eQTL mapping studies, where genetic variations are correlated with expression patterns to identify functional relationships .

What are the challenges in expressing and purifying functional recombinant ATP6?

Expression and purification of functional membrane proteins like ATP6 present several significant challenges:

  • Membrane protein solubility: ATP6 contains multiple transmembrane domains, making it inherently hydrophobic and difficult to solubilize without compromising structure and function.

  • Expression systems: Selection of appropriate expression systems is critical. While bacterial systems offer high yield, eukaryotic systems like insect cells may provide better folding for complex membrane proteins.

  • Detergent selection: The choice of detergents for solubilization significantly impacts protein stability and activity. Screening multiple detergents is often necessary to identify optimal conditions.

  • Maintaining native conformation: ATP6 functions as part of a multi-subunit complex; expressing it in isolation may result in misfolding or instability.

  • Purification strategy: Affinity tags must be carefully selected and positioned to avoid interfering with protein function. The tag type for recombinant Lumbricus terrestris ATP6 is typically determined during the production process to optimize yield and functionality .

How can Lumbricus terrestris ATP6 be used to investigate the evolution of bioenergetic systems?

Lumbricus terrestris ATP6 provides a valuable model for investigating evolutionary adaptations in bioenergetic systems across metazoan lineages:

  • Comparative genomics: Sequence analysis of ATP6 across evolutionary diverse species can reveal conservation patterns and lineage-specific adaptations. This approach has been productive in studies of c-subunit stoichiometry, which varies from c8 in mammalian mitochondria to c14 in chloroplasts, with corresponding impacts on proton/ATP ratios and energetic efficiency .

  • Structure-function relationships: Mapping sequence variations to functional domains can illuminate how evolutionary pressures shape energy production mechanisms. Research has shown that variations in c-ring stoichiometry affect both thermodynamic efficiency and kinetic properties of ATP synthesis .

  • Physiological adaptations: Earthworms occupy diverse ecological niches with varying metabolic demands. Studying ATP6 variations within Lumbricus and related species can reveal adaptations to different environmental conditions.

  • Molecular evolution rates: Analysis of evolutionary rates in ATP6 compared to other ATP synthase subunits can identify regions under selective pressure, similar to analyses that have highlighted adaptations in photosynthetic organisms that maintain specific pmf (proton motive force) conditions to prevent deleterious side reactions .

  • Horizontal gene transfer assessment: Mitochondrial genes like ATP6 can be used to track evolutionary relationships and potential horizontal gene transfer events.

What techniques can be used to study the proton translocation mechanism involving ATP6?

Investigating the proton translocation mechanism in ATP6 requires sophisticated biophysical and biochemical approaches:

  • Site-directed mutagenesis: Systematic mutation of conserved residues in the predicted proton channels can identify key amino acids involved in proton translocation.

  • Liposome reconstitution assays: Purified ATP6 (ideally within the complete ATP synthase complex) can be reconstituted into liposomes for direct measurement of proton pumping activity.

  • Electrophysiology: Patch-clamp techniques applied to reconstituted proteins or isolated mitochondria can measure proton currents through ATP synthase.

  • Spectroscopic techniques: Fluorescent probes sensitive to pH or membrane potential can track proton movement in real-time.

  • Molecular dynamics simulations: Computational approaches can model proton movement through the ATP6 channel, providing insights into the molecular mechanisms of translocation.

  • Structural biology: High-resolution structures obtained through cryo-electron microscopy can reveal the architectural details of proton channels and conformational changes during the catalytic cycle.

What is the relationship between ATP6 mutations and bioenergetic disorders in comparative animal models?

While specific research on Lumbricus terrestris ATP6 mutations and disorders is limited, the broader literature on ATP synthase provides valuable insights:

  • Mitochondrial diseases: In humans and other mammals, ATP6 mutations are associated with several mitochondrial disorders including NARP (Neuropathy, Ataxia, and Retinitis Pigmentosa) and MILS (Maternally Inherited Leigh Syndrome). Comparative studies in model organisms could elucidate conservation of pathogenic mechanisms.

  • Functional consequences: ATP6 mutations typically impair proton translocation efficiency, reducing ATP synthesis capacity and increasing production of reactive oxygen species. Similar bioenergetic consequences would be expected in earthworm models with comparable mutations.

  • Compensatory mechanisms: Different species may have evolved varied compensatory mechanisms to mitigate the effects of ATP6 dysfunction. For instance, the adaptation of c-ring stoichiometry in photosynthetic organisms appears to balance efficiency with protection against deleterious side reactions of high membrane potential .

  • Tissue-specific effects: The impact of ATP6 mutations often varies across tissues, reflecting different energetic demands and mitochondrial densities. Single-cell RNA sequencing approaches similar to those used in C. elegans could help map these tissue-specific effects in Lumbricus terrestris .

  • Environmental interactions: Environmental factors may modulate the phenotypic expression of ATP6 mutations, particularly in poikilothermic organisms like earthworms where temperature directly affects metabolic rate.

How should researchers design experiments to compare ATP6 function across different annelid species?

A comprehensive experimental design for comparative analysis of ATP6 function should include:

  • Species selection: Include multiple annelid species representing different ecological niches and evolutionary distances. Beyond Lumbricus terrestris, consider aquatic, semi-terrestrial, and fully terrestrial species.

  • Standardized isolation protocols: Develop consistent methods for mitochondrial isolation across species to minimize technical variables. This might build upon cell dissociation techniques like those used in C. elegans, adapted for the specific tissues of annelids .

  • Functional assays: Measure key parameters including:

    • ATP synthesis rates under standardized conditions

    • Proton translocation efficiency

    • Oxygen consumption rates

    • Response to inhibitors

    • pH and temperature optima

  • Sequence and structural analysis: Perform complete sequencing of ATP6 genes across species, coupled with structural predictions to correlate sequence variations with functional differences.

  • Expression systems: Develop heterologous expression systems to test the function of ATP6 variants, potentially using chimeric proteins to identify domains responsible for species-specific functional differences.

  • Environmental variables: Test function under different conditions relevant to species' natural habitats, including temperature, pH, and oxygen availability.

  • Statistical approach: Implement phylogenetically corrected statistical methods to account for evolutionary relationships when analyzing functional differences.

What are the key considerations for interpreting ATP synthase kinetic data in the context of ATP6 variations?

When interpreting kinetic data related to ATP6 variations, researchers should consider:

  • Proton motive force (pmf) components: The relationship between ATP synthesis rates and pmf is complex. ATP synthase with different c-ring stoichiometries shows distinct pmf activation thresholds and turnover rates . Similarly, variations in ATP6 may affect both the threshold for activation and the kinetic response to increasing pmf.

  • Thermodynamic vs. kinetic effects: Variations in ATP6 may affect both the thermodynamic efficiency (H+/ATP ratio) and the kinetics of ATP synthesis. These effects should be distinguished experimentally as they have different implications for cellular energetics.

  • Context dependency: The functional impact of ATP6 variations may depend on:

    • pH gradient vs. membrane potential components of pmf

    • Total available pmf in the experimental system

    • Substrate availability (ADP, Pi)

    • Temperature and other environmental factors

  • Rate-limiting steps: Researchers must determine whether observed kinetic differences relate to proton translocation (F0 function) or catalytic site operation (F1 function). In thylakoids, ATP synthase turnover is strongly dependent on pmf amplitude, suggesting that the rate-limiting step requires pmf .

  • Integrated system analysis: ATP synthase operates within a complex bioenergetic network. Changes in ATP6 function may trigger compensatory adjustments in other components of energy metabolism.

  • Evolutionary context: Interpret kinetic differences in light of species' ecological niches and evolutionary history. As suggested for c-ring variations, different H+/ATP stoichiometries may reflect adaptations to specific energetic constraints or environmental conditions .

How can researchers effectively integrate ATP6 structural data with functional assays?

Effectively integrating structural and functional data requires a multi-layered approach:

  • Structure-guided mutagenesis: Use structural information to identify potentially important residues in ATP6, particularly those lining predicted proton channels or at interfaces with other subunits. Systematic mutagenesis of these residues coupled with functional assays can validate structural predictions.

  • Computational modeling: Molecular dynamics simulations based on structural data can generate testable hypotheses about proton pathways and conformational changes during the catalytic cycle.

  • Correlation analysis: Systematically correlate structural variations across species with differences in functional parameters like proton translocation efficiency, ATP synthesis rates, and inhibitor sensitivity.

  • Chimeric proteins: Design chimeric ATP6 proteins that combine structural elements from different species to identify domains responsible for specific functional properties.

  • Environmental responsiveness: Investigate how structural elements respond to environmental variables such as pH, temperature, and membrane lipid composition, and correlate these responses with functional changes.

  • Evolutionary analysis: Map functional and structural variations onto phylogenetic trees to identify convergent or divergent evolution patterns that may indicate adaptive significance.

  • Integration with omics data: Combine structural and functional studies with transcriptomic and proteomic data to understand how ATP6 variations affect broader cellular processes, similar to the whole-organism eQTL mapping approaches used in C. elegans studies .

What role might Lumbricus terrestris ATP6 play in understanding mitochondrial evolution?

Lumbricus terrestris ATP6 represents a valuable model for investigating mitochondrial evolution for several reasons:

  • Evolutionary position: As members of Annelida, earthworms occupy an informative phylogenetic position for understanding mitochondrial gene evolution across metazoan lineages.

  • Genomic features: Analysis of the ATP6 gene's sequence, codon usage, and genetic code variations can provide insights into mitochondrial genome evolution. This approach has proven valuable in other systems, such as the comparative analysis of ATP synthase c-rings that revealed different stoichiometries evolved across phylogenetic lineages .

  • Horizontal gene transfer: Mitochondrial genes like ATP6 can be examined for evidence of horizontal gene transfer events that may have influenced the evolution of bioenergetic systems.

  • Selection pressures: Comparative analysis of synonymous versus non-synonymous substitution rates in ATP6 across lineages can reveal evolutionary selection pressures on mitochondrial function.

  • Co-evolution patterns: Investigating co-evolution patterns between ATP6 and other mitochondrial and nuclear-encoded subunits of ATP synthase can illuminate constraints on protein-protein interactions during evolutionary divergence.

  • Environmental adaptations: Lumbricus terrestris, as a soil-dwelling organism, faces unique environmental challenges that may have driven specific adaptations in mitochondrial function, similar to the adaptations observed in photosynthetic organisms that evolved large c-rings potentially to maintain specific pmf conditions .

How might research on Lumbricus terrestris ATP6 contribute to understanding drug resistance mechanisms in parasitic helminths?

While Lumbricus terrestris is not a parasitic species, research on its ATP6 could provide valuable insights into drug resistance mechanisms relevant to parasitic helminths:

  • Conserved targets: Many anthelmintic drugs target energy metabolism pathways, including components that interact with ATP synthase. Understanding the structure and function of ATP6 in the non-parasitic Lumbricus could help identify conserved features that might serve as drug targets.

  • Resistance mechanisms: Molecular mechanisms of drug resistance often involve mutations in target proteins. Studies of natural variations in Lumbricus ATP6 could help predict potential resistance mutations in parasitic species, similar to how β-tubulin variations have been identified as sources of benzimidazole resistance in Trichuris species .

  • Comparative analysis: Systematic comparison between ATP6 from Lumbricus and parasitic helminths could reveal lineage-specific adaptations that might be exploited for selective targeting.

  • Model system: As a readily available and easily maintained laboratory model, Lumbricus offers opportunities to test hypotheses about energy metabolism and drug effects that may be difficult to study directly in parasitic species.

  • Evolutionary context: Understanding the evolutionary relationships between free-living and parasitic worms can provide context for interpreting functional differences in ATP6 and predicting how these might influence drug susceptibility or resistance development.

What novel approaches could advance our understanding of ATP6 regulation in response to environmental stressors?

Several innovative approaches could enhance our understanding of ATP6 regulation under environmental stress:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.