Recombinant Lumbricus terrestris NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Protein Overview

ND6 is a core subunit of mitochondrial Complex I (NADH:ubiquinone oxidoreductase, EC 1.6.5.3), which transfers electrons from NADH to ubiquinone during ATP synthesis . The recombinant earthworm (Lumbricus terrestris) ND6 is expressed in E. coli with a His-tag and purified to >90% homogeneity .

Key Features:

PropertyDescription
SpeciesLumbricus terrestris (Common earthworm)
Expression SystemEscherichia coli
TagN-terminal His-tag
Protein LengthFull-length (1-156 amino acids)
Amino Acid SequenceMILTSFMLMMIATTFTLYLASTPIVLGVNILMMALLLASTFASFMSSWFAFLIFLIYIGG... (156 residues)
Molecular FormLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Recombinant Expression

The ND6 gene (UniProt ID: Q34944) is cloned and expressed in E. coli, followed by affinity chromatography using the His-tag . Key production metrics include:

ParameterSpecification
Purity>90% (SDS-PAGE verified)
Storage-20°C/-80°C in aliquots; avoid freeze-thaw
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Role in Mitochondrial Complex I

ND6 anchors Complex I to the mitochondrial inner membrane, facilitating electron transfer from NADH to ubiquinone . Mutations in homologous human MT-ND6 cause disorders like Leber hereditary optic neuropathy (LHON) and Leigh syndrome, underscoring its functional conservation across species .

Catalytic Activity:

  • Turnover Rate: ~10⁴ min⁻¹ (NADH:ubiquinone reductase activity in murine models) .

  • Dysfunction Impact: Disrupts ATP synthesis and increases reactive oxygen species (ROS) .

Experimental Use Cases

  • Enzyme Kinetics: Quantifying Complex I activity in mitochondrial isolates .

  • Disease Modeling: Studying LHON-like pathologies via ND6 mutagenesis .

  • Structural Biology: Resolving electron transport mechanisms in annelids .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them in your order. We will prepare according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Lumbricus terrestris (Common earthworm)
Target Names
ND6
Target Protein Sequence
MILTSFMLMMIATTFTLYLASTPIVLGVNILMMALLLASTFASFMSSWFAFLIFLIYIGG MLVMFAYFLALTPNQQISNFNIMPYALITLLTFSALTYTTNIKIPTFSDISQGNSILYMS STAPFLILLALILLLTMVIVVKLTSRSSGPLRPFSP
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). This subunit is believed to be part of the minimal assembly required for catalysis. Complex I functions in transferring electrons from NADH to the respiratory chain. Ubiquinone is believed to be the enzyme's immediate electron acceptor.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of ND6 in Lumbricus terrestris?

NADH-ubiquinone oxidoreductase chain 6 (ND6) is a mitochondrially-encoded subunit of complex I in the respiratory chain. In Lumbricus terrestris, as in other organisms, this protein plays a crucial role in energy metabolism. Evolutionary analysis indicates high conservation of ND6 among vertebrates, suggesting similar conservation patterns may exist in annelids . When conducting comparative genomic studies, researchers should extract the ND6 sequence from the recently assembled Lumbricus terrestris mitochondrial genome and align it with homologous sequences from related species to identify conserved domains and species-specific variations.

How does Lumbricus terrestris ND6 compare structurally to other annelid species?

Structural comparison requires sequence alignment of the Lumbricus terrestris ND6 gene from its 15.93 kilobase mitochondrial genome with ND6 sequences from related annelid species . Research methodologies should include:

  • Multiple sequence alignment using MUSCLE or Clustal Omega

  • Phylogenetic tree construction to visualize evolutionary relationships

  • Protein structure prediction using homology modeling

  • Conservation analysis of functional domains

The recent completion of the Lumbricus terrestris genome assembly provides a foundational resource for these comparative analyses, enabling researchers to identify unique structural features that may relate to the species' ecological adaptations .

What protocols are recommended for isolating mitochondria from Lumbricus terrestris tissues?

For optimal mitochondrial isolation from Lumbricus terrestris tissues:

  • Harvest fresh tissue samples from posterior segments, avoiding the gut to prevent contamination

  • Homogenize tissues in isolation buffer (250 mM sucrose, 10 mM HEPES, 1 mM EDTA, pH 7.4) at 4°C

  • Perform differential centrifugation: initial low-speed centrifugation (1,000 g for 10 minutes) followed by high-speed centrifugation of the supernatant (10,000 g for 15 minutes)

  • Resuspend the mitochondrial pellet in a suitable buffer for downstream applications

This protocol can be adapted from methods used for studying mitochondrial function in earthworms in plastic bioremediation experiments, where maintaining mitochondrial integrity was essential for assessing metabolic responses .

What methodologies are most effective for expressing recombinant Lumbricus terrestris ND6?

Expressing functional recombinant ND6 presents significant challenges due to its hydrophobic nature and mitochondrial origin. The most effective approach involves:

  • Codon optimization for the expression system (typically E. coli or yeast)

  • Addition of solubility tags (e.g., MBP, SUMO, or GST)

  • Expression in cell-free systems to avoid toxicity

  • Use of specialized E. coli strains designed for membrane protein expression

For validation, employ a cybrid approach similar to that used in mtDNA variant studies, where patient-derived cells with mitochondrial defects are fused with cells lacking mtDNA to confirm pathogenicity of specific variants . This methodology can be adapted to verify the functionality of recombinant Lumbricus terrestris ND6 by complementation studies in cell lines with ND6 deficiency.

How can researchers differentiate between pathogenic and non-pathogenic variations in Lumbricus terrestris ND6?

To distinguish pathogenic from non-pathogenic variations in Lumbricus terrestris ND6, implement a multi-step validation approach:

  • Sequence analysis to identify variants using the assembled mitochondrial genome as reference

  • Conservation analysis across species to determine if the variant affects evolutionarily conserved residues

  • Enzyme activity assays to measure complex I function (similar to those used in MRCD studies)

  • Cybrid studies to confirm causality of the variant in mitochondrial dysfunction

  • Complementation studies with wild-type ND6 to restore function

This methodological framework mirrors approaches used to validate the pathogenicity of human ND6 mutations, such as the m.14439G>A variant that causes complex I deficiency . For Lumbricus terrestris, researchers should adapt these techniques to the specific biological context of annelid mitochondrial function.

What are the technical challenges in studying ND6 mutations in an earthworm model system?

Studying ND6 mutations in Lumbricus terrestris presents several technical challenges:

  • Limited genetic manipulation tools compared to model organisms

  • Difficulty in maintaining consistent laboratory populations due to the earthworm's complex life cycle

  • Challenges in creating stable transgenic lines

  • Mitochondrial heteroplasmy assessment requires specialized techniques

To overcome these challenges, researchers can:

  • Develop primary cell cultures from earthworm tissues

  • Utilize CRISPR/Cas9 targeting the nuclear genome for indirect mitochondrial studies

  • Apply heteroplasmy detection methods using PCR-RFLP analysis similar to those used for human mtDNA variants

  • Develop earthworm-specific cybrid models to study mitochondrial function

How can researchers assess the impact of environmental stressors on ND6 function in Lumbricus terrestris?

To evaluate how environmental stressors affect ND6 function in Lumbricus terrestris:

  • Design mesocosm experiments with controlled exposure to stressors (similar to plastic exposure studies)

  • Collect earthworms at defined time points for tissue sampling

  • Isolate mitochondria and perform enzyme activity assays specifically targeting complex I

  • Sequence ND6 to identify stress-induced mutations

  • Quantify ND6 expression using qRT-PCR

  • Measure mitochondrial respiration rates using oxygen consumption assays

This experimental approach can build upon methodologies used in studies examining earthworm responses to plastic contamination, where probiotics enhanced survival rates and modified microbial communities . By specifically focusing on ND6 function, researchers can determine whether mitochondrial adaptations contribute to stress tolerance.

What controls should be included when studying recombinant Lumbricus terrestris ND6 in vitro?

When studying recombinant Lumbricus terrestris ND6 in vitro, include these essential controls:

  • Positive functional control: Well-characterized mammalian ND6 with known activity

  • Negative control: Inactive ND6 variant (e.g., site-directed mutant at a conserved residue)

  • Expression vector-only control: To differentiate between effects of the expression system and the recombinant protein

  • Wild-type Lumbricus terrestris mitochondrial extract: As benchmark for native activity levels

  • Enzyme kinetics control: Standard substrate concentration curves to ensure reactions are within linear range

For complex I activity assays, researchers should use protocols adapted from those employed in studies of mitochondrial respiratory chain disorders, where both spectrophotometric and polarographic methods are used to measure NADH oxidation and electron transfer capacity .

How can researchers effectively measure complex I activity in Lumbricus terrestris tissues?

For accurate measurement of complex I activity in Lumbricus terrestris tissues:

MethodApplicationMeasurement ParameterAdvantagesLimitations
Spectrophotometric assayTissue homogenates, isolated mitochondriaNADH oxidation rateHigh throughput, quantitativePotential interference from other NADH-oxidizing enzymes
Polarographic methodIsolated mitochondriaOxygen consumptionDirect measurement of electron transportRequires specialized equipment
Blue native PAGEIsolated mitochondriaIn-gel activityPreserves native protein complexesSemi-quantitative
RespirometryIntact cells, tissue samplesOxygen consumption ratePhysiologically relevantLess specific for complex I

The methodology should be adapted from approaches used in diagnosing mitochondrial respiratory chain disorders, where enzyme assays are crucial for identifying deficiencies in specific complexes . For Lumbricus terrestris, tissue-specific optimization is necessary, particularly for the posterior segments where mitochondrial density is highest.

What statistical approaches are most appropriate for analyzing ND6 sequence variants in Lumbricus terrestris populations?

When analyzing ND6 sequence variants in Lumbricus terrestris populations:

  • Use population genetics metrics (FST, nucleotide diversity) to assess genetic structure

  • Apply McDonald-Kreitman test to identify signatures of selection

  • Use maximum likelihood or Bayesian methods for phylogenetic reconstruction

  • Implement heteroplasmy quantification using next-generation sequencing data

Statistical significance should be evaluated using appropriate models that account for the unique characteristics of mitochondrial inheritance patterns. Researchers can build upon genomic data from the recently assembled Lumbricus terrestris genome to establish baseline frequencies of variants in natural populations .

How can researchers distinguish between functional and non-functional ND6 variants?

To differentiate between functional and non-functional ND6 variants in Lumbricus terrestris:

  • Conservation analysis: Align ND6 sequences across related species to identify evolutionarily conserved residues

  • Structural modeling: Predict the impact of variants on protein structure using homology modeling

  • Functional complementation: Test variant ND6 ability to restore complex I function in deficient systems

  • Cybrid studies: Compare complex I activity in cells containing variant versus wild-type mtDNA

This methodological framework is similar to approaches used to validate the pathogenicity of human MT-ND6 variants, where cybrid studies confirmed that the m.14439G>A variant caused complex I deficiency while showing that another variant (m.1356A>G) was non-pathogenic .

What are the implications of heteroplasmy for ND6 research in Lumbricus terrestris?

Heteroplasmy—the presence of multiple mitochondrial genomes within a cell—has significant implications for ND6 research in Lumbricus terrestris:

  • Threshold effects: Functional impairment may only occur when mutant mtDNA exceeds a certain percentage

  • Tissue specificity: Heteroplasmy ratios may vary across tissues, requiring tissue-specific sampling

  • Inheritance patterns: Understanding maternal transmission and potential selection during development

  • Quantification methods: PCR-RFLP analysis for targeted variants or next-generation sequencing for comprehensive assessment

Researchers should develop Lumbricus terrestris-specific heteroplasmy detection methods, adapting techniques such as the mismatch PCR-RFLP analysis used to determine heteroplasmy ratios in human mtDNA variants . Quantitative assessment of heteroplasmy is essential for understanding the functional consequences of ND6 mutations.

How can Lumbricus terrestris ND6 research contribute to understanding bioremediation mechanisms?

Lumbricus terrestris ND6 research can enhance our understanding of bioremediation through:

  • Investigating how mitochondrial function correlates with the earthworm's ability to process environmental contaminants

  • Studying ND6 expression changes in response to soil pollutants

  • Examining the relationship between ND6 variants and earthworm survival in contaminated environments

  • Exploring how probiotics that enhance earthworm survival in plastic-contaminated soil affect mitochondrial function

Recent research demonstrates that probiotics improved survival rates of earthworms exposed to plastics while increasing the abundance of microbial groups involved in plastic bioremediation . Understanding how these interventions affect mitochondrial function, particularly complex I activity where ND6 plays a crucial role, could reveal mechanisms underlying enhanced survival and remediation capacity.

What methodologies bridge ecological and molecular studies of Lumbricus terrestris ND6?

To effectively connect ecological and molecular aspects of Lumbricus terrestris ND6 research:

  • Field-to-laboratory approach: Collect earthworms from various ecological conditions and assess ND6 sequence variation and function

  • Mesocosm experiments: Design controlled environmental systems mimicking natural conditions while enabling molecular sampling

  • Molecular biomarkers: Develop ND6-based markers for earthworm population health and adaptation

  • Functional ecology: Connect mitochondrial function to ecological roles such as soil aggregation and organic matter processing

These integrated approaches can build upon methodologies used in studies of earthworm introduction into different soil types, where survival and reproduction were carefully monitored in mesocosm settings . By incorporating molecular analyses of ND6 function into such ecological experimental designs, researchers can establish direct links between mitochondrial function and ecological performance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.