Recombinant Lymnaea stagnalis Octopamine receptor 1

What is Lymnaea stagnalis Octopamine receptor 1?

Lymnaea stagnalis Octopamine receptor 1 is a G-protein coupled receptor found in the central nervous system of the great pond snail (Helix stagnalis). This receptor binds the neurotransmitter octopamine and plays a significant role in the neurophysiology of the snail's nervous system. The full-length receptor consists of 638 amino acids with specific structural domains that enable its function in signal transduction pathways .

The receptor is part of an octopaminergic system within the snail's CNS, where octopamine functions as a neurotransmitter and neuromodulator. This system is particularly important in the buccal ganglia of Lymnaea stagnalis, where octopamine plays a major role in regulating feeding-related behaviors .

What is the molecular structure and composition of Lymnaea stagnalis Octopamine receptor 1?

The Lymnaea stagnalis Octopamine receptor 1 is a full-length protein of 638 amino acids. Its amino acid sequence is:

MSRDIFMKRLRLHLLFDEVAMVTHIVGDVLSSVLLCAVVLLVLVGNTLVVAAVATSRKLR TVTNVFIVNLACADLLLGVLVLPFSAVNEIKDVWIFGHVWCQVWLAVDVWLCTASILNLC CISLDRYLAITRPIRYPGLMSAKRAKTLVAGVWLFSFVICCPPLIGWNDGGDGIMDYNGT TATPIPVTTTQTPVTGRDDVLCDNGFNYSTNSNMNTTCTYSGDSSLSTTCELTNSRGYRI YAALGSFFIPMLVMVFFYLQIYRAAVKTISAYAKGELKTKYSVRENGSKTNSVTLRIHRG GRGPSTGSSVYRHGSTYGGSAAGAATREGCGDKDAAGGRRFGRQEMDSHLPVRKCRSSDA SLVTLTGLKCEIIDNGNAKHGPISELIKGRGKSFFWRKEKKRSVGGERESFENSTRNGRS TRAKLCGGRCLAIETDICSSGECSPRTKRIKEHARATQHNSLPVTPSLSSQNEETDAVFV RGTSNSEYKPRRSRLSAHKPGHAMRLHMQKFNREKKAAKTLAIIVGAFIMCWMPFFTIYL VGAFCENCISPIVFSVAFWLGYCNSAMNPCVYALFSRDFRFAFRKLLTCSCKAWSKNRSF RPQTSDVPAIQLHCATQDDAKSSSDIGPTASGGNGGYT

The protein contains multiple transmembrane domains characteristic of G-protein coupled receptors, which enable it to span the cell membrane and transduce signals from the extracellular environment to intracellular signaling pathways.

How is octopamine distributed in the Lymnaea stagnalis central nervous system?

Octopamine shows an inhomogeneous distribution in the central nervous system of Lymnaea stagnalis. HPLC measurements reveal that:

• The buccal ganglia contain the highest concentration of octopamine at 18.8 pmol mg⁻¹

• The pedal ganglia have intermediate levels at 9.2 pmol mg⁻¹

• The cerebral ganglia contain 4.9 pmol mg⁻¹

• No detectable amount of octopamine is found in the visceroparietal complex

This distribution pattern is similar to that observed in Helix pomatia (terrestrial snail), which shows buccal ganglia concentrations of 12.6 pmol mg⁻¹, pedal ganglia at 4.93 pmol mg⁻¹, and cerebral ganglia at 4.46 pmol mg⁻¹ . The higher concentration in buccal ganglia correlates with octopamine's important role in feeding-related behaviors.

What expression systems are used for recombinant Lymnaea stagnalis Octopamine receptor 1?

The recombinant full-length Lymnaea stagnalis Octopamine receptor 1 protein is primarily expressed in Escherichia coli (E. coli) expression systems. For research applications, the protein is typically produced with an N-terminal His tag to facilitate purification and detection . The recombinant protein spans the full length (amino acids 1-638) of the native receptor and is usually supplied as a lyophilized powder for experimental use .

The expression in bacterial systems like E. coli provides advantages for large-scale production of the protein for biochemical and structural studies, though it may lack some post-translational modifications present in the native receptor.

What signaling pathways are associated with Lymnaea stagnalis Octopamine receptor 1?

The signaling pathways associated with Lymnaea stagnalis Octopamine receptor 1 involve adenylyl cyclase-dependent mechanisms, similar to octopamine responses in insects . Experimental evidence suggests that:

• In the B1 motoneuron, octopamine activation leads to depolarization through a cAMP-dependent pathway

• This pathway is enhanced by IBMX (phosphodiesterase inhibitor), which increases cAMP levels

• Forskolin (a direct adenylyl cyclase activator) mimics the octopamine response

• The membrane-permeable cAMP analog 8-bromo-cAMP also depolarizes the B1 motoneuron

• G-protein antagonist GDP-β-S blocks the response, confirming G-protein coupling

These observations support that Lymnaea stagnalis Octopamine receptor 1 couples to Gs proteins, activating adenylyl cyclase to increase cAMP levels, which subsequently modulates neuronal excitability through downstream effectors.

What are the electrophysiological responses to octopamine in Lymnaea stagnalis neurons?

Electrophysiological studies reveal different responses to octopamine across various identified neurons in the Lymnaea stagnalis CNS:

The B1 motoneuron depolarization response is enhanced by preincubation with IBMX (10 μM) and can be mimicked by direct cyclase activator forskolin (50 μM) or by 8-bromo-cAMP (2 mM) .

The hyperpolarization responses in B2 and B3 neurons operate through different mechanisms, as they are not affected by modulators of the cAMP pathway . The B3 neuron shows a particularly high sensitivity to octopamine with a threshold concentration approximately 10 times lower than the other neurons.

These differential responses suggest the presence of multiple octopamine receptor subtypes or different coupling mechanisms within the Lymnaea stagnalis nervous system.

How does the pharmacological profile of Lymnaea stagnalis Octopamine receptor compare to other octopamine receptors?

The pharmacological properties of the Lymnaea stagnalis Octopamine receptor have been characterized through binding and functional studies. Interestingly, despite being from Lymnaea stagnalis, the receptor's pharmacological profile more closely resembles insect OA2 receptors rather than the cloned Lymnaea OA receptor .

Specific OA-ergic agents that selectively inhibit octopamine responses include:

• Phentolamine

• Demethylchlordimeform

• 2-chloro-4-methyl-2-(phenylimino)-imidazolidine

Among dopamine antagonists:

• Ergotamine reversibly inhibits octopamine responses

• Sulpiride shows no effect on octopamine responses

The binding characteristics of the receptor have been determined through Scatchard analysis of ligand binding data:

• In Lymnaea: Kd = 84.9 ± 17.4 nM and Bmax = 3803 ± 515 fmol g⁻¹ tissue

• In Helix: Kd = 33.7 ± 5.95 nM and Bmax = 1678 ± 179 fmol g⁻¹ tissue

These binding parameters suggest a single receptor site with moderate affinity for octopamine.

What are the challenges in characterizing octopamine uptake mechanisms in Lymnaea stagnalis?

Octopamine uptake in Lymnaea stagnalis presents a complex system with multiple components. The synaptosomal fraction from Lymnaea ganglia exhibits a biphasic uptake mechanism with:

• A high-affinity component: Km1 = 4.07 ± 0.51 μM, Vmax1 = 0.56 ± 0.11 pmol mg⁻¹ per 20 min

• A low-affinity component: Km2 = 47.6 ± 5.2 μM, Vmax2 = 4.2 ± 0.27 pmol mg⁻¹ per 20 min

This dual-component uptake system complicates the study of octopamine neurotransmission as it suggests multiple mechanisms for regulating extracellular octopamine levels.

Additionally, pharmacological studies of octopamine receptors face challenges such as:

• The need for extremely high concentrations (1-3 mM) of cyclase blockers SQ 22536 and Rp-cAMPS to see effects

• The possibility that the tissue sheath or glial cells prevent drugs from reaching the neurons

• Differential responses across neuronal types that require cell-specific approaches

These challenges necessitate careful experimental design when studying octopamine signaling in the Lymnaea stagnalis nervous system.

How can recombinant Lymnaea stagnalis Octopamine receptor 1 be stored and reconstituted for experimental use?

Proper storage and reconstitution of recombinant Lymnaea stagnalis Octopamine receptor 1 is crucial for maintaining its functional integrity in experimental settings. The recommended protocol is:

Storage conditions:

• Store at -20°C/-80°C upon receipt

• Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

• Briefly centrifuge the vial prior to opening to bring contents to the bottom

• Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add 5-50% glycerol (final concentration) and aliquot for long-term storage

• The default final concentration of glycerol is 50%

Storage buffer composition:

• Tris/PBS-based buffer

• 6% Trehalose

• pH 8.0

The reconstituted protein should have a purity greater than 90% as determined by SDS-PAGE. Repeated freezing and thawing is not recommended as it may compromise protein integrity and functionality.

What is the evolutionary relationship between Lymnaea stagnalis Octopamine receptor and other invertebrate monoamine receptors?

The Lymnaea stagnalis Octopamine receptor 1 belongs to the larger family of G-protein coupled receptors that bind monoamine neurotransmitters. Pharmacological characterization suggests that the Lymnaea octopamine receptor more closely resembles insect OA2 receptors than the cloned Lymnaea OA receptor , which indicates a complex evolutionary history.

This resemblance to insect receptors rather than other molluscan receptors raises interesting questions about:

• Convergent evolution of receptor properties

• Ancestral receptor types that diverged differently across invertebrate lineages

• Functional constraints that may have shaped receptor pharmacology similarly across distant taxa

Comparative studies of octopamine receptors across invertebrate phyla could yield valuable insights into the evolution of monoaminergic signaling systems and their roles in behavior and physiology. The conservation of specific binding domains and signal transduction mechanisms across species could reveal fundamental principles of GPCR function that have been maintained through evolutionary time.

How is immunocytochemistry used to study octopamine systems in Lymnaea stagnalis?

Immunocytochemical labeling has been successfully employed to visualize octopamine-containing neurons in the Lymnaea stagnalis central nervous system. This technique has revealed:

• The presence of OA-immunoreactive neurons and fibers in the buccal, cerebral, and pedal ganglia

• The absence of OA-immunoreactive elements in the visceroparietal complex, consistent with the HPLC findings

• The distribution pattern of octopaminergic neurons correlates with their functional importance in feeding and locomotion

The immunocytochemical approach typically involves:

• Fixation of the isolated CNS

• Sectioning the tissue

• Incubation with primary antibodies against octopamine

• Visualization using fluorescent or enzymatic secondary detection methods

• Microscopic analysis to map the distribution of labeled cells and processes

This technique complements biochemical and electrophysiological approaches by providing spatial information about octopamine-containing elements in the nervous system.

What electrophysiological methods are used to characterize Lymnaea stagnalis Octopamine receptor function?

Electrophysiological characterization of Lymnaea stagnalis Octopamine receptor function involves several specialized techniques:

• Preparation:

  • Isolation of the CNS and pinning it down in a bath

  • Continuous perfusion with saline at 1ml/min

  • Penetration of visually identified neurons (B1, B2, B3) using glass micropipettes

  • Application of 0.1% protease (Sigma XIV) to assist penetration

• Recording setup:

  • Signal amplification and recording to computer disk using software like DasyLab

  • Ability to switch between normal saline and high Ca/high Mg saline or low Ca/high Mg saline to reduce synaptically mediated background

• Drug application methods:

  • Bath application of octopamine at various concentrations

  • Preincubation with modulators of signaling pathways (IBMX, forskolin)

  • Application of receptor antagonists to characterize pharmacological profiles

  • Local application of octopamine onto identified neurons

• Response characterization:

  • Measurement of membrane potential changes

  • Determination of response thresholds

  • Characterization of dose-response relationships

  • Analysis of response kinetics

These methods allow for detailed functional characterization of octopamine receptors in their native neuronal environment, providing insights into their physiological roles and signaling mechanisms.

How can Lymnaea stagnalis serve as a model for translational neuroscience research?

Lymnaea stagnalis offers significant advantages as a model for translational neuroscience research, particularly in the study of monoaminergic signaling systems:

• Well-characterized nervous system:

  • Identifiable neurons with consistent properties across individuals

  • Accessible ganglia allowing for precise electrophysiological recordings

  • Mappable neural circuits controlling defined behaviors

• Evolutionary insights:

  • The octopaminergic system in molluscs shares similarities with adrenergic systems in vertebrates

  • Comparative studies can reveal fundamental principles of monoaminergic signaling conserved across animal phyla

  • Understanding of evolutionary relationships between different receptor types

• Learning and memory models:

  • Lymnaea exhibits measurable learning and memory processes

  • The role of octopamine in these processes can be studied at cellular and molecular levels

  • Insights may apply to understanding reward systems across species

• Practical advantages:

  • Relatively simple nervous system compared to vertebrates

  • Large neurons facilitate electrophysiological and molecular studies

  • Well-established techniques for studying receptor function in native context

These characteristics make Lymnaea stagnalis a valuable model for understanding the fundamental mechanisms of neuromodulation by biogenic amines, with potential implications for human neurological and psychiatric conditions involving monoaminergic signaling.

What are emerging approaches for studying Lymnaea stagnalis Octopamine receptor structure-function relationships?

Future research on Lymnaea stagnalis Octopamine receptor 1 will likely leverage advanced techniques to elucidate structure-function relationships:

• Cryo-electron microscopy:

  • Determination of high-resolution receptor structure

  • Visualization of ligand binding sites

  • Understanding conformational changes during activation

• CRISPR-Cas9 genome editing:

  • Generation of receptor mutants in Lymnaea stagnalis

  • Study of structure-function relationships in vivo

  • Analysis of behavioral consequences of receptor modifications

• Optogenetic approaches:

  • Light-controlled activation of octopaminergic neurons

  • Temporal precision in studying receptor-mediated responses

  • Integration of receptor function into circuit-level understanding

• Advanced heterologous expression systems:

  • Expression in mammalian cell lines for functional studies

  • Development of stable cell lines for high-throughput screening

  • Co-expression with various G proteins to study coupling specificity

These approaches will provide deeper insights into how the structural features of Lymnaea stagnalis Octopamine receptor 1 determine its functional properties and contribute to the physiology of the nervous system.

How might comparative studies of octopamine receptors advance our understanding of GPCR evolution?

Comparative studies of octopamine receptors across species offer a unique window into GPCR evolution:

• Phylogenetic analysis:

  • Reconstruction of evolutionary relationships between octopamine, tyramine, dopamine, and adrenergic receptors

  • Identification of ancestral receptor types and their divergence patterns

  • Understanding of how receptor specificities evolved across invertebrate lineages

• Structural comparisons:

  • Identification of conserved domains critical for ligand binding and G-protein coupling

  • Understanding of how structural changes relate to functional diversity

  • Recognition of convergent evolution in receptor properties

• Functional conservation:

  • Comparison of signaling pathways across species

  • Identification of conserved cellular responses to receptor activation

  • Understanding of how receptor function relates to behavioral outputs

• Ecological and behavioral context:

  • Correlation of receptor properties with ecological niches

  • Understanding how environmental pressures shaped receptor evolution

  • Insights into the adaptive significance of octopamine signaling

These comparative approaches will help establish Lymnaea stagnalis Octopamine receptor 1 within the broader context of GPCR evolution and may reveal fundamental principles governing the structure, function, and regulation of this important receptor family.

What is the current state of Lymnaea stagnalis Octopamine receptor research?

Current research on Lymnaea stagnalis Octopamine receptor 1 has established its basic molecular properties, pharmacological profile, and role in neuronal signaling. Key findings include:

• The receptor consists of 638 amino acids and can be expressed as a recombinant protein with an N-terminal His tag in E. coli systems

• Octopamine distribution in the Lymnaea CNS is highest in the buccal ganglia, with significant levels also in pedal and cerebral ganglia

• Different neurons exhibit distinct responses to octopamine:

  • B1 neurons: depolarization through a cAMP-dependent pathway

  • B2/B3 neurons: hyperpolarization through cAMP-independent mechanisms

• The pharmacological profile of the receptor more closely resembles insect OA2 receptors than other cloned Lymnaea receptors

• The receptor functions in a complex octopaminergic system that likely plays important roles in feeding and other behaviors

Despite these advances, many aspects of the receptor's structure-function relationships, its role in neural circuits, and its contribution to behavior remain to be fully elucidated. The availability of recombinant protein and established experimental techniques position the field for significant future discoveries.