Recombinant Lymnaea stagnalis Octopamine receptor 2

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant OA2 is derived from the central nervous system (CNS) of Lymnaea stagnalis and produced in heterologous expression systems for biochemical and pharmacological studies. Key specifications include:

PropertyDetailsSource
UniProt IDO01670
Protein LengthFull-length (1-578 amino acids) or partial sequences
Host SystemsE. coli, Baculovirus, Mammalian cells, Yeast
TagsHis-tag (N-terminal) or variable tags depending on expression system
Purity>85–90% (verified by SDS-PAGE)
Storage-20°C/-80°C (lyophilized or liquid form; shelf life: 6–12 months)

The full-length OA2 protein contains conserved transmembrane domains typical of G protein-coupled receptors (GPCRs), with a molecular weight of approximately 65–70 kDa .

Functional Roles in Lymnaea stagnalis

OA2 mediates octopamine signaling, which influences diverse physiological processes:

Feeding Modulation

  • OA2 activation in the buccal ganglia regulates feeding rhythms via synaptic connections with motoneurons (B1, B2) and modulatory interneurons .

  • Electrophysiological studies show that OA application hyperpolarizes B2 neurons, reducing feeding rates, while antagonists like phentolamine block this effect .

Locomotory Control

  • OA2 antagonists (e.g., mianserin) increase locomotory speed in Lymnaea by suppressing inhibitory octopaminergic inputs to cilia-driven movement .

  • Unlike insects, OA2 in Lymnaea does not uniformly utilize cAMP pathways; B1 neurons employ cAMP, while B2/B3 neurons use alternative second messengers .

Neural Plasticity

  • OA2 is implicated in memory consolidation, as shown by RNAi-mediated silencing experiments that impair olfactory recall in invertebrates .

Research Applications

Recombinant OA2 is utilized in:

  • Ligand-Binding Assays: Pharmacological profiling using agonists/antagonists (e.g., NC-7, demethylchlordimeform) .

  • Structural Studies: Mapping receptor-ligand interactions via site-directed mutagenesis .

  • Comparative Neurobiology: Contrasting octopamine signaling pathways across mollusks and insects .

Key Research Findings

Study FocusMethodologyOutcomeCitation
Feeding CircuitryIntracellular recording + immunocytochemistryIdentified OA-immunoreactive OC neurons synaptically linked to feeding networks
Second MessengerscAMP pathway inhibitors + electrophysiologyConfirmed cAMP-dependent signaling in B1 neurons, non-cAMP in B2/B3
LocomotionBehavioral assays + OA antagonistsOA2 blockade increased upside-down gliding speed by 40–60%

Technical Considerations

  • Reconstitution: Requires addition of 5–50% glycerol for long-term stability .

  • Antibody Cross-Reactivity: Anti-OA2 sera show specificity to intracellular epitopes (e.g., peptide DFRFAFKSIICKCFC) .

  • Species Specificity: OA2 in Lymnaea shares <30% sequence homology with insect orthologs, necessitating species-specific tools .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please specify it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it according to your requirements.
Synonyms
Octopamine receptor 2; OA2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Lymnaea stagnalis (Great pond snail) (Helix stagnalis)
Target Protein Sequence
MMSFPIALFADVNQSFRANLVVSSYHHAITFPTVRGANFSTFFPRNFSVSADVWLCGANF SQEWQLMQPVCSTKYDSITIFITVAVVLTLITLWTILGNFFVLMALYRYGTLRTMSNCLI GNLAISDLLLAVTVLPISTVHDLLGYWVFGEFTCTLWLCMDVLYCTASIWGLCTVAFDRY LATVYPVWYHDQRSVRKAVGCIVFVWIFSIVISFAPFIGWQHMIPSFFSFNASIQRYQCI LFTSSSYVLYSSMGSFVIPAILMAFMYVRIFVVLHNQSRGVKFKSGLKISSSKYNGCPVI NEPSREGINGLGRDVTNTTLLSDAVGSSADLTSNGKDDPRVLATAPIELTEDVPPLNGHH HRTVHETPYVSGLHTKRSNSFALPTELEKKCKPLTNNILHMMDFDRRNSHNAVIQRSASE MVNLDVSKHELLISNVCHRSKSATALTSETGDPLGSLAGPRRSLQCNVGGLVRNKHMTLS MKRRFELREQRATKRMLLIMACFCVCWMPFLFMYILRSVCDTCHMNQHFVAAIIWLGYVN SSLNPVLYTLFNDDFKVAFKRLIGARSPSAYRSPGPRR
Uniprot No.

Target Background

Function
This receptor is a receptor for octopamine, a neurotransmitter, neurohormone, and neuromodulator found in invertebrates. It induces a prolonged opening of voltage-independent chloride channels, a process that appears to involve protein phosphorylation but does not require either cAPK or PKC. The order of potency for agonists is as follows: p-synephrine > p-octopamine > xylometazoline > B-HT920 > norepinephrine = clonidine > epinephrine > p-tyramine > phenylephrine = oxymetazoline = mehoxamine = dopamine > serotonin > histamine. The order of potency for antagonists is as follows: rauwolscine = mianserin > phentolamine > chlorpromazine > spiperone > yohimbine > propanolol > alprenolol > prazosine > pindolol.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Lymnaea stagnalis Octopamine receptor 2 and why is it significant for research?

    Lymnaea stagnalis Octopamine receptor 2 (OA2) is a G-protein coupled receptor found in the great pond snail (Lymnaea stagnalis). This receptor is significant for research because octopamine functions as a key neuromodulator in invertebrate nervous systems, particularly in regulating feeding behavior. Studies have shown that octopamine antagonists such as phentolamine, demethylchlordimeform (DCDM), and 2-chloro-4-methyl-2-(phenylimino)-imidazolidine (NC-7) significantly inhibit sucrose-induced feeding responses in Lymnaea stagnalis, with phentolamine completely blocking feeding at doses of 25-50 mg/kg . The receptor consists of 578 amino acids and shares structural similarities with adrenergic receptors found in vertebrates .

  • How is octopamine distributed in the Lymnaea stagnalis central nervous system?

    Octopamine shows an inhomogeneous distribution in the Lymnaea stagnalis central nervous system. HPLC analysis reveals that the buccal ganglia contain significantly higher concentrations of octopamine (18.8 pmol mg⁻¹) compared to the pedal ganglia (9.2 pmol mg⁻¹) and cerebral ganglia (4.9 pmol mg⁻¹) . Interestingly, no detectable amount of octopamine could be assayed in the visceroparietal complex. This differential distribution correlates with octopamine's role in feeding behavior, as the buccal ganglia control radula movement during feeding . Immunocytochemical labeling has demonstrated the presence of octopamine-immunoreactive neurons and fibers primarily in the buccal, cerebral, and pedal ganglia .

Advanced Research Questions

  • What methodologies exist for studying the functional properties of Recombinant Lymnaea stagnalis Octopamine receptor 2?

    Several methodologies have been developed to study the functional properties of octopamine receptors:

    a) Heterologous Expression Systems: Similar to studies with other invertebrate octopamine receptors, Lymnaea OA2 can be expressed in heterologous systems such as HEK-293 cells to study signaling pathways. For example, with the silkworm BmOAR1 receptor, researchers measured changes in intracellular cAMP and Ca²⁺ concentrations in response to octopamine application .

    b) Electrophysiological Techniques: Whole-cell patch-clamp recordings can be used to measure neuronal responses to octopamine application. In Lymnaea stagnalis, local application of octopamine onto identified buccal neurons (e.g., B2 neuron) evokes hyperpolarization that can be selectively inhibited by octopaminergic agents .

    c) Binding Assays: Radioligand binding assays using ³H-octopamine can characterize receptor binding properties. The Scatchard analysis of ligand binding data for Lymnaea stagnalis octopamine receptors showed a one-binding site, with Kd and Bmax values of 84.9 ± 17.4 nM and 3803 ± 515 fmol g⁻¹ tissue, respectively .

    d) Pharmacological Characterization: Applying specific octopamine receptor agonists and antagonists can help characterize receptor function. For octopamine receptors in Lymnaea, phentolamine, demethylchlordimeform, and 2-chloro-4-methyl-2-(phenylimino)-imidazolidine have been used as antagonists .

  • How does the Octopamine receptor 2 contribute to feeding neural circuits in Lymnaea stagnalis?

    The Octopamine receptor 2 plays crucial roles in modulating feeding circuits in Lymnaea stagnalis:

    a) OC Interneurons: Paired octopamine-containing (OC) interneurons in the buccal ganglia are integral components of the feeding neural network. These neurons have been identified through electrophysiological criteria and confirmed to be octopamine-immunoreactive through double labeling experiments (intracellular staining with Lucifer yellow followed by octopamine immunocytochemistry) .

    b) Neural Network Integration: OC neurons display rhythmic activity patterns during both spontaneous and interneuron-driven fictive feeding, firing specifically in the third, swallowing (N3) phase of the feeding cycle . They form diverse synaptic connections with the feeding network:

    • Electrical coupling with B4 cluster motoneurons

    • Chemical synaptic connections with feeding motoneurons (B1, B2 cells)

    • Connections with the SO modulatory interneuron

    c) Reconfiguration of Feeding Networks: OC interneurons can stimulate and reconfigure the Lymnaea feeding system. They modulate all other interneurons and motor neurons of the buccal feeding network through monophasic, biphasic, and long-term effects .

    d) Pharmacological Evidence: Octopamine antagonists injected into intact snails significantly reduce feeding responses to sucrose. Phentolamine (25-50 mg/kg) completely inhibits feeding, while NC-7 reduces feeding by 80-90% and DCDM by 20-60% .

  • What are the comparative characteristics of octopamine receptors between Lymnaea stagnalis and other invertebrate species?

    Comparative analysis of octopamine receptors reveals important similarities and differences across invertebrate species:

    a) Receptor Classification: The Lymnaea stagnalis octopamine receptor resembles the insect OA2 receptor subtype rather than the cloned Lymnaea OA receptor according to pharmacological characterization . This suggests multiple receptor subtypes may exist within the same species.

    b) Structural Homology: The Bombyx mori octopamine receptor (BmOAR1) shows high sequence identity with octopamine receptors from Periplaneta americana (Pa oa1), Apis mellifera (AmOA1), and Drosophila melanogaster (OAMB or DmOA1A) . Comparative studies with Lymnaea stagnalis OA2 would provide insights into evolutionary conservation of these receptors.

    c) Signaling Pathways: While Lymnaea stagnalis OA2 signaling hasn't been fully characterized, other invertebrate octopamine receptors like BmOAR1 signal through both cAMP and Ca²⁺ pathways when stimulated with octopamine concentrations above 1 μM and 100 nM respectively . This α-adrenergic-like signaling profile is likely conserved in Lymnaea stagnalis OA2.

    d) Pharmacological Profile: The pharmacological properties of octopamine receptors vary across species. In binding competition studies with BmOAR1, the rank order of antagonist activity was chlorpromazine > mianserin = yohimbine, with cyproheptadine and metoclopramide having little effect . For Lymnaea receptors, phentolamine, demethylchlordimeform, and NC-7 are effective antagonists .

  • What are the best methodologies for studying the molecular mechanisms of Octopamine receptor 2 in behavioral conditioning?

    Several methodologies have been established to study how octopamine receptor 2 contributes to behavioral conditioning:

    a) Conditioned Taste Aversion (CTA): Lymnaea stagnalis is particularly suitable for studying CTA, as demonstrated by numerous research studies . While obtaining Lymnaea stagnalis may be challenging in some regions due to restrictions on transporting live snails across state lines, they remain the preferred model for CTA research. The methodology involves:

    • Training snails to associate a taste stimulus with a negative consequence

    • Testing memory formation and recall at different time intervals

    • Pharmacological manipulation of octopamine receptors using antagonists

    • Electrophysiological recording from feeding neurons before and after conditioning

    b) Pharmacological Interventions: Octopamine receptor antagonists can be administered at different stages of memory formation to determine when receptor activation is necessary:

    • Pre-training administration to study acquisition

    • Post-training administration to study consolidation

    • Pre-testing administration to study recall

    Similar approaches in honeybees using mianserin (an OA receptor antagonist) and AmOAR double-stranded RNA to silence receptor expression showed that both treatments inhibited olfactory acquisition and recall without disrupting odor discrimination .

    c) Molecular Approaches: RNA interference (RNAi) techniques can be used to knock down octopamine receptor expression in Lymnaea stagnalis, similar to approaches used in Apis mellifera . This allows for specific targeting of receptor subtypes and avoids potential off-target effects of pharmacological agents.

    d) Combining Behavioral and Electrophysiological Methods: Correlating behavioral outcomes with changes in neuronal activity provides insights into the cellular mechanisms of learning. Single-cell recordings from identified neurons in semi-intact preparations allow for direct observation of how octopamine receptor activation influences neural plasticity during learning .

  • How can subcellular localization of Octopamine receptor 2 be visualized in Lymnaea stagnalis neurons?

    Advanced imaging techniques have been developed to visualize the subcellular localization of neuropeptides and receptors in Lymnaea stagnalis neurons:

    a) Matrix-Enhanced Secondary Ion Mass Spectrometry (ME-SIMS): This technique combines the high mass capabilities of MALDI with the high spatial resolution of SIMS to create high-resolution molecular maps at the subcellular level. ME-SIMS has successfully visualized neuropeptide distributions in Lymnaea stagnalis neurons with submicrometer spatial resolution .

    b) Double Labeling Techniques: To identify octopamine-containing neurons, researchers have used double labeling by first injecting Lucifer Yellow intracellularly for morphological identification, followed by octopamine immunocytochemistry . This approach could be adapted to visualize octopamine receptors by combining electrophysiological identification with immunocytochemistry using antibodies against Octopamine receptor 2.

    c) Retrograde Tracing Combined with Mass Spectrometry: Retrograde tracing using nickel-lysine dye can identify neurons connected within a circuit. This approach has been used to label neurons in the right parietal ganglion (RPaG) of Lymnaea stagnalis for subsequent MALDI-MS analysis of their neuropeptide content . Similar approaches could be used to study the distribution of Octopamine receptor 2 within specific neural circuits.

    d) Immunogold Electron Microscopy: For ultrastructural localization, immunogold electron microscopy can be applied using antibodies against Octopamine receptor 2, allowing visualization of receptor distribution at synaptic and extrasynaptic sites. This approach provides nanometer-scale resolution of receptor localization.

  • What are the challenges in producing functional Recombinant Lymnaea stagnalis Octopamine receptor 2 for structural studies?

    Several challenges exist in producing functional recombinant Octopamine receptor 2 for structural studies:

    a) Expression Systems: While E. coli is commonly used for recombinant protein production, G-protein coupled receptors often require eukaryotic expression systems to ensure proper folding and post-translational modifications. Alternative expression systems include:

    • Baculovirus-infected insect cells, which have been used successfully for some recombinant Lymnaea stagnalis proteins

    • Yeast expression systems

    • Mammalian cell lines for functional studies

    b) Protein Stability: Membrane proteins like Octopamine receptor 2 are notoriously difficult to purify in a stable, functional form. The current commercially available recombinant Lymnaea stagnalis Octopamine receptor 2 is supplied with 50% glycerol and 6% trehalose to enhance stability . Techniques to improve stability include:

    • Screening different detergents for solubilization

    • Using lipid nanodiscs or other membrane mimetics

    • Engineering thermostabilizing mutations

    c) Functional Verification: Ensuring the recombinant receptor maintains its native pharmacological properties is crucial. Binding assays using radiolabeled ligands can verify receptor functionality. For Lymnaea stagnalis octopamine receptors, previous studies have established binding parameters (Kd of 84.9 ± 17.4 nM) that can serve as benchmarks for recombinant protein validation.

    d) Crystallization Challenges: For X-ray crystallography studies, obtaining diffraction-quality crystals of GPCRs remains challenging. Alternative structural approaches include:

    • Cryo-electron microscopy, which doesn't require crystallization

    • NMR spectroscopy for structural dynamics studies

    • Computational modeling based on homologous receptors

  • How can transcriptomic and proteomic approaches advance our understanding of Octopamine receptor 2 signaling in Lymnaea stagnalis?

    Integrative 'omics approaches offer powerful tools for understanding Octopamine receptor 2 signaling:

    a) Transcriptomics: RNA sequencing can identify genes differentially expressed following octopamine receptor activation or inhibition. This approach can reveal downstream signaling pathways and target genes regulated by octopamine signaling. With the growing multi-omics coverage for Lymnaea stagnalis and an impending annotated genome , transcriptomic analyses are becoming increasingly feasible.

    b) Mass Spectrometry-Based Proteomics: Mass spectrometry has been successfully applied to study neuropeptide localization in Lymnaea stagnalis at different levels of granularity, from the whole CNS to subcellular details in identified neurons . Similar approaches can be applied to:

    • Profile changes in the proteome following octopamine receptor activation

    • Identify interacting partners of Octopamine receptor 2 through pull-down assays

    • Characterize post-translational modifications that regulate receptor function

    c) Single-Cell Transcriptomics: Given the identified octopamine-containing neurons (OC neurons) in Lymnaea stagnalis , single-cell RNA sequencing of these specific neurons could provide insights into their molecular signatures and the genes co-expressed with octopamine receptors.

    d) Phosphoproteomics: Since GPCRs like Octopamine receptor 2 typically signal through phosphorylation cascades, phosphoproteomic analysis following receptor activation can map downstream signaling pathways. This approach has been used successfully in other invertebrate models to delineate neuromodulator signaling networks.

Research Applications and Future Directions

  • What role does Octopamine receptor 2 play in environmental stress responses in Lymnaea stagnalis?

    Lymnaea stagnalis has been established as a sensitive and reliable species for ecotoxicological studies , and octopamine signaling may play important roles in stress responses:

    a) Hypoxia Response: Chronic hypoxia causes neural dysfunction in Lymnaea stagnalis, affecting presynaptic protein profiles and neurobehaviors. Studies have shown that hypoxia delays animal response to light stimuli, suppresses locomotory activity, and alters expression of stress-response proteins . Given octopamine's role in modulating neural circuits, Octopamine receptor 2 may be involved in adapting neural function under hypoxic conditions.

    b) Toxicant Exposure: Lymnaea stagnalis is used for metal-risk assessment, studying effects of pesticides, nanotoxicology, and developing toxicokinetic models . Research methodologies include:

    • Measuring Octopamine receptor 2 expression levels following toxicant exposure

    • Assessing changes in octopamine-dependent behaviors

    • Electrophysiological recording from identified octopaminergic neurons in exposed animals

    c) Climate Change: Lymnaea stagnalis has been used for global warming risk assessment . Considering octopamine's role in feeding behavior, changes in Octopamine receptor 2 function could mediate behavioral adaptations to temperature stress.

    d) Immune Response: Parasitic infections alter snail neurophysiology, metabolism, immunity, growth, and reproduction . Investigating whether octopamine signaling is involved in coordinating these responses could provide insights into neuroimmune interactions.

  • How can genome editing technologies be applied to study Octopamine receptor 2 function in Lymnaea stagnalis?

    With advances in genome editing technologies and growing genetic resources for Lymnaea stagnalis, several approaches can be used to study Octopamine receptor 2 function:

    a) CRISPR/Cas9 Gene Editing: With an impending annotated genome for Lymnaea stagnalis , CRISPR/Cas9 technology could be used to:

    • Generate knockout models to study the phenotypic consequences of Octopamine receptor 2 loss

    • Introduce point mutations to study structure-function relationships

    • Create tagged versions of the receptor for visualization in living cells

    b) Transgenic Approaches: Developing transgenic lines expressing fluorescently tagged Octopamine receptor 2 would allow for real-time visualization of receptor trafficking and localization.

    c) Conditional Expression Systems: Establishing inducible expression systems would enable temporal control over Octopamine receptor 2 expression, allowing researchers to dissect its role during specific developmental stages or physiological processes.

    d) RNA Interference: RNAi techniques, which have been successfully used to silence octopamine receptor expression in Apis mellifera , could be adapted for Lymnaea stagnalis to achieve transient knockdown of Octopamine receptor 2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.