Recombinant Lysine exporter protein (lysE)

Shipped with Ice Packs
In Stock

Description

Industrial Applications in L-Lysine Production

LysE is pivotal for optimizing L-lysine bioproduction, which exceeds 2 million tons annually .

Overexpression Strategies

  • C. glutamicum: Overexpressing native LysE increases export rates by 5-fold, enhancing titers in industrial strains .

  • Methylophilus methylotrophus: A mutated LysE variant improves L-lysine yield by 10-fold .

Novel Exporters: MglE

A metagenomic study identified MglE (EamA superfamily), which:

  • Boosts tolerance: Increases L-lysine tolerance in E. coli by 40% .

  • Enhances productivity: Raises L-lysine yield in C. glutamicum by 7.8–12% and titers by 9.5% .

ExporterOrganismLysine ToleranceBiomass ImpactKey Advantage
LysEC. glutamicumModerateNoneWell-characterized
MglEE. coliHigh-50% biomassNovel, sequence-independent
ybjEE. coliModerateNoneLower export efficiency

Medical Relevance in Mycobacterium tuberculosis

LysE (Rv1986) is critical for M. tuberculosis survival and virulence:

  • Toxicity mitigation: Prevents cytoplasmic accumulation of L-lysine, which inhibits growth .

  • Pathogenicity: Expressed under hypoxia, a hallmark of latent TB infection .

  • Therapeutic target: Inhibiting LysE could suppress bacterial growth and enhance drug efficacy .

Research Methods: Cloning and Purification

Recombinant LysE is purified using immobilized metal affinity chromatography (IMAC):

  1. Cloning: Insert lysE into plasmids (e.g., pZE-RCL-MglE for E. coli) .

  2. Expression: Induce in E. coli or C. glutamicum; check for inclusion bodies .

  3. Purification: Use Ni-NTA columns; achieve >95% purity with urea denaturation if needed .

Comparative Analysis of Lysine Exporters

FeatureLysELysO (YbjE)MglE
FamilyLysE (PF01810)Major Facilitator SuperfamilyEamA
SubstratesL-lysine, L-arginineL-lysineL-lysine
EfficiencyHighModerateHigh (metagenomic origin)
Industrial UseEstablishedLimitedEmerging

Future Directions

  • Structural studies: Elucidate LysE’s transport mechanism using cryo-EM .

  • Vaccine development: Rv1986 as a TB vaccine candidate due to its absence in BCG .

  • Bioprocess optimization: Integrate MglE into C. glutamicum strains for higher yields .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate your needs during order placement. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
lysE; DIP1091; Lysine exporter LysE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
Target Names
lysE
Target Protein Sequence
MSIAIAGFLMGLSLIVAIGPQNALIIRQGIKREGLIPILVVCILSDVILIFGGTAGVGAL VDRAPIALVVLKWLGVAYLLYFGFTCFKEAFKRHGQALAVEQSEPVAYEPVADASSGVIT KTRTKAQPKSAQRTWVKPVLAALAFTWLNPAAYIDVLVMLGGIANQHGPDGRWVFALGAL CASLTWFPFIGYTSTRFSTVLSRPAVWRYINIAIGIIMMIMCARLIMH
Uniprot No.

Target Background

Function
Catalyzes the efflux of L-lysine.
Database Links

KEGG: cdi:DIP1091

Protein Families
LysE/ArgO transporter (TC 2.A.75) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Lysine exporter protein (LysE)?

LysE is a transmembrane carrier protein in Corynebacterium glutamicum that specifically exports L-lysine to regulate its intracellular concentration. This 236 amino acyl residue protein exhibits six hydrophobic domains that correspond to six transmembrane helical spanners typical of many polytopic membrane transport proteins . LysE represents the founding member of the LysE superfamily of transport proteins, which includes carriers that export amino acids, lipids, and heavy metal ions . The protein lacks significant sequence similarity to other known export translocators and represents a novel family of proteins distinct from all established families of transporters .

What is the biological significance of LysE?

LysE serves a critical regulatory function by preventing toxic accumulation of L-lysine in the bacterial cytoplasm. This function is particularly important in environments containing peptides; in the presence of lysine-containing peptides, deletion of the lysE gene leads to exceptionally high cytoplasmic concentrations of L-lysine (exceeding 1M), resulting in bacteriostasis . This export mechanism is surprising since L-lysine biosynthesis in C. glutamicum, as in other bacteria, is already strictly regulated . The specific export function provided by LysE is also a prerequisite for industrial L-lysine production with C. glutamicum, which produces approximately 3.5×10^5 tons of this amino acid annually . Thus, LysE represents both a novel regulatory mechanism and an industrial target.

What is known about the structural topology of LysE?

LysE displays a 3+3 topological arrangement with six transmembrane segments (TMSs) . This arrangement consists of two homologous three-TMS repeat units, suggesting evolutionary origins from a 3-TMS precursor protein through duplication events . Multiple sequence alignments and analysis of average hydropathy, amphipathicity, and similarity (AveHAS) plots reveal that the most conserved regions correspond to predicted TMS#1 and TMS#6 .

A distinctive feature of the LysE topology is a large hydrophilic region separating TMSs #3 and #4, which corresponds to regions that are highly dissimilar across the superfamily . This structural organization is consistent with other members of the expanded LysE superfamily, supporting an evolutionary model where all members arose from a 3-TMS precursor via duplication .

How should I design a cloning strategy for recombinant LysE expression?

When designing a cloning strategy for recombinant LysE expression, several critical factors must be considered:

Table 1: Key Considerations for LysE Cloning Strategy

ParameterRecommendationRationale
Expression vectorpET-based vectors with T7 promoterProvides tight control for potentially toxic membrane proteins
Affinity tagC-terminal His6 or His10 tagAvoids interference with N-terminal membrane insertion
Fusion partnerGFP or SUMOMonitors expression/folding (GFP) or enhances solubility (SUMO)
Codon optimizationOptimize for expression hostParticularly important for C. glutamicum genes in E. coli
Signal sequenceConsider native vs. modifiedMay affect membrane insertion efficiency
Restriction sitesAvoid sites within lysE geneVerify sequence for internal restriction sites

A typical workflow would include:

  • PCR amplification of the lysE gene (708 bp) from C. glutamicum genomic DNA using primers containing appropriate restriction sites

  • Restriction digestion and ligation into the selected expression vector

  • Verification by restriction analysis and DNA sequencing

  • Transformation into a suitable expression host

For membrane proteins like LysE, consider including a short linker (e.g., GSGS) between the protein and any affinity tag to improve accessibility during purification. Additionally, site-directed mutagenesis to remove potential internal proteolytic sites might improve protein stability during expression and purification.

What expression systems are most suitable for recombinant LysE production?

The choice of expression system significantly impacts the yield and functionality of recombinant membrane proteins like LysE. Based on general principles for membrane protein expression, the following systems should be considered:

Table 2: Comparison of Expression Systems for Recombinant LysE

Expression SystemAdvantagesDisadvantagesRecommended Strains/Conditions
E. coli- Rapid growth
- Easy genetic manipulation
- Economical
- Potential toxicity
- Inclusion body formation
- Lacks eukaryotic PTMs
C41(DE3), C43(DE3), Lemo21(DE3)
Induction at 18-20°C
Low IPTG concentration (0.1-0.5 mM)
Yeast- Eukaryotic processing
- High-density cultivation
- Good for scaled production
- Longer expression time
- Different membrane composition
- Glycosylation can be excessive
Pichia pastoris (Komagataella phaffii)
Methanol induction protocol
Controlled pH fermentation
Cell-free- Rapid production
- Direct incorporation into liposomes
- Avoids toxicity issues
- Limited production scale
- Expensive
- May require optimization
E. coli extract supplemented with:
- Lipid nanodiscs or liposomes
- Detergents (DDM, LMNG)

For LysE specifically, E. coli-based expression systems using specialized strains for membrane proteins are likely to be most cost-effective for initial studies. The protein should be expressed at low temperatures (16-20°C) following induction to minimize aggregation and maximize proper membrane insertion.

Key recommendations include:

  • Screen multiple constructs with different tags and fusion partners in parallel

  • Optimize induction conditions (temperature, inducer concentration, duration)

  • Monitor expression through Western blotting or GFP fluorescence if using a fusion

  • Include appropriate control constructs to benchmark expression efficiency

What purification methods yield high-quality recombinant LysE protein?

Purification of membrane proteins like LysE requires specialized approaches to maintain structural integrity and function. The following methodological workflow is recommended:

  • Membrane Preparation:

    • Cell lysis via mechanical disruption (French press or sonication)

    • Differential centrifugation: low-speed (10,000×g) to remove debris followed by high-speed (100,000×g) to isolate membranes

    • Membrane washing with high-salt buffer (e.g., 500 mM NaCl) to remove peripheral proteins

  • Detergent Screening and Solubilization:

Table 3: Recommended Detergents for LysE Solubilization

DetergentCMC (mM)Working ConcentrationProperties
DDM0.171-2%Mild, widely used for membrane proteins
LMNG0.010.5-1%Enhanced stability, lower CMC
DMNG0.0360.5-1%Good for crystallization
Digitonin0.51-2%Very mild, good for sensitive proteins
  • Affinity Purification:

    • IMAC using Ni-NTA or TALON resin for His-tagged LysE

    • Careful optimization of imidazole in wash buffers (typically 20-40 mM)

    • Elution with 250-300 mM imidazole

  • Size Exclusion Chromatography:

    • Final purification step using Superdex 200 or equivalent

    • Assessment of protein homogeneity and oligomeric state

    • Buffer exchange to remove imidazole and adjust detergent concentration

  • Stability Enhancement:

    • Addition of specific lipids (e.g., E. coli polar lipids, 0.1-0.2 mg/ml)

    • Inclusion of glycerol (10-20%) in all buffers

    • Consideration of cholesterol hemisuccinate (CHS) at 0.1% to stabilize membrane domains

Throughout the purification process, it is essential to maintain the protein at 4°C and include protease inhibitors. The final purified LysE should be characterized by SDS-PAGE, Western blotting, mass spectrometry, and analytical SEC to verify purity, identity, and monodispersity before functional studies.

How can I measure LysE transport activity in vitro?

Measuring the transport activity of LysE requires reconstitution into artificial membrane systems that mimic the native environment. The following methodological approach is recommended:

Liposome Reconstitution Protocol:

  • Prepare liposomes from E. coli polar lipids or synthetic lipid mixtures (e.g., POPC:POPE:POPG at 7:2:1)

  • Preload liposomes with L-lysine (typically 10-50 mM)

  • Incorporate purified LysE at protein-to-lipid ratios of 1:50 to 1:200 (w/w)

  • Remove detergent by dialysis or Bio-Beads adsorption

  • Purify proteoliposomes by size exclusion chromatography or density gradient centrifugation

Transport Assay Methods:

Table 4: Comparison of Transport Assay Methods for LysE

MethodPrincipleAdvantagesLimitations
Radiolabeled substrateTrack ³H or ¹⁴C-labeled lysine efflux- Direct measurement
- High sensitivity
- Quantitative
- Requires radioactive materials
- Lower temporal resolution
Fluorescent lysine analogsMonitor fluorescence changes- Real-time measurements
- No radioactivity
- High temporal resolution
- Potential altered specificity
- Background fluorescence issues
FRET-based sensorsDetect lysine via conformational changes- Highly sensitive
- Spatial resolution possible
- Complex setup
- Requires sensor development
pH indicator dyesDetect pH changes if H⁺-coupled- Simple implementation
- Real-time measurements
- Indirect measurement
- Requires ion coupling

For data analysis, initial transport rates should be calculated from the linear portion of the time course. Kinetic parameters (Km and Vmax) can be determined by varying substrate concentrations. Control experiments are essential, including:

  • Proteoliposomes without LysE (passive diffusion control)

  • Heat-inactivated LysE (protein-specific control)

  • Addition of ionophores to dissipate ion gradients (mechanism control)

Given LysE's 3+3 TMS arrangement and its physiological role in exporting lysine , assays should be designed to specifically measure efflux rather than uptake to reflect its native function.

What methods can reveal the membrane topology and structural features of LysE?

Elucidating the membrane topology of LysE requires combining computational and experimental approaches:

  • Computational Topology Prediction:

    • Hydropathy analysis indicates six transmembrane segments in a 3+3 arrangement

    • Topology prediction algorithms (TMHMM, MEMSAT, Phobius) provide initial models

    • Evolutionary analysis supports a structure derived from a 3-TMS precursor through duplication

  • Experimental Topology Mapping:

Table 5: Experimental Methods for LysE Topology Determination

MethodApproachAdvantagesLimitations
Reporter fusionsFusion of PhoA/GFP/LacZ at various positions- In vivo assessment
- Relatively straightforward
- May disrupt protein folding
- Limited resolution
Cysteine scanningIntroduce single cysteines and test accessibility- High resolution
- Can probe dynamics
- Labor-intensive
- Requires cysteine-free background
Protease protectionDigest exposed regions and analyze fragments- Direct approach
- No protein modification
- Low resolution
- Complex interpretation
EPR spectroscopySpin-labeled residues report on environment- Dynamic information
- Conformational details
- Requires stable protein
- Specialized equipment
  • Advanced Structural Analysis:

    • Cryo-electron microscopy provides medium to high-resolution structures without crystallization

    • X-ray crystallography if well-diffracting crystals can be obtained

    • Solid-state NMR for specific structural questions

  • Validation Approaches:

    • Cross-linking studies to identify residue proximities

    • Hydrogen-deuterium exchange mass spectrometry to identify solvent-exposed regions

    • Molecular dynamics simulations to refine structural models

Previous analyses of LysE confirm a topology involving 6 transmembrane segments in a 3+3 pattern, with the most similar regions corresponding to predicted TMS#1 and TMS#6 . A large hydrophilic region separates TMSs #3 and #4 , which should be considered when designing topology experiments.

How is LysE related to other membrane transporters evolutionarily?

LysE belongs to a diverse superfamily of transport proteins with fascinating evolutionary relationships:

  • Expansion of the LysE Superfamily:

    • Originally included only the LysE, RhtB, and CadD families

    • Now expanded to include: NAAT, CaCA2, MntP, ILT, TerC, NicO, GAP, and DsbD families

    • Statistical evidence confirms relationships between these families (Table 2 in source )

  • Structural Conservation and Diversification:

Table 6: Structural Features Across the LysE Superfamily

FamilyCore TMSsAdditional TMSsTransported Substrates
LysE6 (3+3)NoneL-lysine
RhtB6 (3+3)NoneAmino acids
CadD6 (3+3)NoneCadmium
TerC6 (3+3)1-3Tellurium
ILT6 (3+3)1-2Various
MntP6 (3+3)NoneManganese
CaCA26 (3+3)NoneCalcium
NAAT6 (3+3)NoneAmino acids
  • Evolutionary Model:

    • All members likely arose from a 3-TMS precursor via duplication events

    • This duplication resulted in the core 6-TMS structure in a 3+3 TMS arrangement found throughout the superfamily

    • Some families (TerC, ILT) acquired additional TMSs, resulting in topologies such as 3+3+1 or 1+3+3

  • Functional Diversification:

    • Most superfamily members function as secondary carriers for heavy metal or amino acid efflux

    • Some catalyze amino acid uptake, heavy metal ion uptake, or transmembrane electron transfer

    • Despite diverse substrates, the core transport mechanism may be conserved

  • Conserved Features:

    • Six TMSs align across all families in the superfamily

    • TMSs #1 and #6 show the highest conservation across families

    • A large hydrophilic region separating TMSs #3 and #4 is a common feature

This evolutionary analysis demonstrates how a basic structural scaffold can be maintained while allowing for significant functional diversification, enabling these transporters to handle various substrates including amino acids, lipids, and heavy metal ions.

What are the critical residues involved in LysE substrate recognition and transport?

Understanding the molecular determinants of LysE function requires identification of critical residues involved in substrate binding and translocation. While specific residue information is not provided in the search results, a comprehensive approach would include:

  • Predictive Analysis:

    • Comparative sequence analysis of LysE homologs to identify conserved residues

    • Focus on charged/polar residues within transmembrane domains which often participate in substrate recognition

    • Analysis of sequence differences between LysE and related transporters with different specificities

Table 7: Potential Critical Residue Types in Membrane Transporters

Residue TypePotential Function in TransportCommon Locations
Charged (R, K, D, E)Substrate binding, ion couplingTMS interfaces, water-accessible cavities
Aromatic (F, Y, W)Substrate coordination, gatingTMS interfaces, binding pockets
Polar (S, T, N, Q)Hydrogen bonding with substrateThroughout transport pathway
GlycineConformational flexibility, helix kinksTMS hinge regions
ProlineStructural kinks, conformational changesMid-TMS positions
  • Experimental Approaches:

    • Alanine-Scanning Mutagenesis: Systematic replacement of residues with alanine to identify those critical for function

    • Structure-Guided Mutagenesis: Once a structural model is available, targeted mutations of predicted binding site residues

    • Charge-Swap Experiments: For charged residues, testing whether function can be restored by complementary mutations

  • Functional Analysis of Mutants:

    • Transport assays using reconstituted proteoliposomes to measure kinetic parameters

    • Substrate specificity profiles to identify changes in transported molecules

    • Thermostability assays to distinguish between structural and functional effects

  • Structural Context:

    • Based on the 3+3 TMS arrangement , critical residues are likely located at the interface between the two 3-TMS repeat units

    • The large hydrophilic region between TMSs #3 and #4 may contribute to substrate selectivity

    • Residues in TMSs #1 and #6, which show high conservation across the superfamily , may play fundamental structural roles

Understanding the substrate recognition mechanism of LysE would provide insights into its unique specificity for L-lysine export and could potentially inform protein engineering efforts to modify substrate range or enhance export efficiency for biotechnological applications.

How do various buffer conditions and lipid environments affect LysE stability and function?

The stability and function of membrane proteins like LysE are highly dependent on their environment. Optimizing these conditions is crucial for both structural and functional studies:

  • Buffer Composition Effects:

Table 8: Buffer Parameter Effects on LysE Stability

ParameterRange to TestPotential Effects
pH6.0-8.0Affects protonation of charged residues, may influence transport mechanism
Salt concentration100-500 mMStabilizes protein-protein interactions, screens surface charges
Salt typeNaCl, KCl, LiClDifferent ions may differentially affect protein stability
Glycerol0-20%Prevents aggregation, stabilizes folded state
Reducing agents0-5 mM DTT/TCEPPrevents oxidative damage, maintains reduced cysteines
  • Lipid Environment Considerations:

    • Native-Like Composition: E. coli polar lipids or synthetic mixtures mimicking bacterial membranes

    • Specific Lipid Requirements: Testing whether specific lipids (PE, PG, cardiolipin) enhance stability

    • Membrane Thickness: Matching hydrophobic thickness of lipids to transmembrane domains

    • Surface Charge: Impact of negatively charged lipids on protein orientation and function

  • Detergent Effects:

    • Micelle Size: Different detergents create different micelle environments around the protein

    • Critical Micelle Concentration (CMC): Maintaining appropriate detergent concentration above CMC

    • Detergent-Lipid Mixed Micelles: Adding lipids to detergent micelles often enhances stability

  • Stabilization Strategies:

    • Substrate Addition: Including L-lysine as a stabilizing ligand

    • Lipid Nanodiscs: Reconstitution into nanodiscs for a more native-like membrane environment

    • Cholesterol or CHS: Addition of sterols can enhance transmembrane domain packing

  • Stability Assessment Methods:

    • Thermal stability assays (nanoDSF, CPM assay)

    • Size-exclusion chromatography to monitor aggregation

    • Activity measurements under varying conditions

Given LysE's role in lysine export and its 6-TMS topology , creating an environment that maintains the integrity of both the transmembrane domains and the large hydrophilic region between TMSs #3 and #4 is likely to be critical for preserving function in vitro.

How might LysE activity be modulated for biotechnological applications?

LysE plays a crucial role in lysine production by C. glutamicum, which is used industrially to produce approximately 3.5×10^5 tons of L-lysine annually . Modulating LysE activity could significantly impact biotechnological applications:

  • Enhancing Lysine Export for Production:

    • Overexpression Strategies: Controlled upregulation of lysE using inducible or constitutive promoters

    • Protein Engineering: Mutagenesis to improve transport kinetics or reduce product inhibition

    • Regulatory Bypass: Modifications to remove native regulatory constraints on LysE expression

Table 9: Potential Protein Engineering Approaches for LysE Enhancement

  • Applications in Other Production Systems:

    • Heterologous Expression: Introduction of LysE into other production organisms to facilitate lysine export

    • Biosensors: Development of LysE-based biosensors for lysine detection in industrial processes

    • Cell-Based Assays: Using LysE-expressing cells for screening lysine production variants

  • Controlling LysE Activity:

    • Conditional Activation: Designing systems where LysE activity can be controlled by external stimuli

    • Feedback Regulation: Engineering modified feedback loops to optimize intracellular lysine levels

    • Protein Stability Control: Degron-based approaches to regulate LysE protein levels

  • Structural Considerations for Engineering:

    • The 3+3 TMS arrangement suggests potential for domain-level engineering

    • The large hydrophilic region between TMSs #3 and #4 could be targeted for modifications that affect transport kinetics

    • Conserved regions in TMSs #1 and #6 might be essential for function and should be preserved

  • Process Integration:

    • Optimizing fermentation conditions to maximize LysE activity

    • Coupling enhanced LysE function with metabolic engineering of lysine biosynthesis

    • Developing continuous extraction systems that take advantage of LysE-mediated export

Understanding the structure-function relationships in LysE would provide the foundation for these biotechnological applications, potentially leading to significant improvements in industrial lysine production efficiency.

What are the key challenges in purifying functional recombinant LysE?

Purification of membrane proteins like LysE presents several significant challenges that must be addressed to obtain functional protein:

Table 10: Common Challenges in LysE Purification and Their Solutions

ChallengeManifestationSolution Approaches
Low expression levelsMinimal protein yield- Optimize codon usage
- Test specialized expression strains
- Try fusion partners to enhance expression
Improper membrane insertionInclusion body formation- Lower induction temperature (16-20°C)
- Reduce inducer concentration
- Add membrane-fluidizing agents
Protein aggregationSize exclusion peaks in void volume- Screen detergents carefully
- Include lipids during solubilization
- Optimize buffer conditions
Detergent-induced denaturationLoss of activity after solubilization- Use milder detergents (DDM, LMNG)
- Add stabilizing lipids
- Include substrate during purification
Proteolytic degradationMultiple bands on SDS-PAGE- Add protease inhibitors throughout
- Keep samples at 4°C
- Minimize purification time

The inherent instability of many membrane proteins contributes to these challenges. For LysE with its 6-TMS topology , maintaining the integrity of transmembrane domains while solubilizing the protein from the membrane is particularly difficult.

Key methodological recommendations include:

  • Developing a reliable detection method (Western blot, activity assay) early in the process

  • Screening multiple detergents in parallel using small-scale extractions

  • Implementing quality control steps at each purification stage

  • Carefully assessing protein homogeneity by SEC-MALS or analytical ultracentrifugation

  • Verifying function through reconstitution experiments before proceeding to structural studies

The large hydrophilic region between TMSs #3 and #4 may present specific challenges, as it could be susceptible to proteolysis or contribute to aggregation if exposed during purification.

How can I overcome common issues in LysE functional reconstitution experiments?

Reconstitution of membrane proteins into liposomes for functional studies presents several challenges. For LysE, with its 6-TMS topology , successful reconstitution requires careful optimization:

  • Protein Quality Issues:

    • Ensure high protein homogeneity by SEC before reconstitution

    • Verify that purified LysE hasn't been denatured by detergent exposure

    • Consider adding substrate (L-lysine) during purification to stabilize native conformation

  • Reconstitution Method Optimization:

Table 11: Comparison of Reconstitution Methods for LysE

MethodPrincipleAdvantagesDisadvantagesRecommendations
Detergent dialysisSlow removal of detergent by dialysisGentle process, good for sensitive proteinsTime-consuming (days), incomplete removalUse for initial attempts, small dialysis buttons
Bio-Beads adsorptionHydrophobic beads adsorb detergentRapid, efficient removalCan adsorb lipids, potential protein bindingMultiple small additions, careful monitoring
Dilution methodRapid dilution below detergent CMCSimple, rapidPotential aggregation, variable efficiencyUse for screening, follow with centrifugation
Direct incorporationAddition to preformed liposomesSimpler procedureLimited efficiency, random orientationBest for screening lipid compositions
  • Lipid Composition Effects:

    • Test both native-like (E. coli polar lipids) and defined synthetic mixtures

    • Consider the impact of lipid charge on protein orientation during reconstitution

    • Optimize lipid:protein ratio (typically 50:1 to 200:1 by weight)

  • Assay-Specific Troubleshooting:

    • For fluorescence-based assays: minimize light scattering, correct for background

    • For radioactive assays: ensure complete separation of liposomes from external medium

    • For all assays: include control liposomes without protein or with inactive protein

  • Orientation Control:

    • Use freeze-thaw cycles to randomize orientation if bidirectional transport is desired

    • Consider asymmetric reconstitution methods for controlling protein orientation

    • Quantify orientation using protease protection assays or antibody accessibility

  • Physical Parameters:

    • Optimize liposome size through extrusion (typically 100-400 nm diameter)

    • Control temperature during reconstitution and functional assays

    • Consider the impact of buffer composition on liposome stability

When troubleshooting, systematic variation of one parameter at a time is essential. Document all conditions carefully and develop a standardized workflow that can be consistently reproduced. For LysE specifically, ensure that assay conditions are designed to detect lysine export rather than import, consistent with its physiological function .

What analytical methods are essential for verifying LysE protein quality?

Ensuring high-quality LysE protein is crucial for meaningful functional and structural studies. A comprehensive analytical toolkit should include:

  • Purity and Integrity Assessment:

Table 12: Essential Analytical Methods for LysE Quality Control

MethodInformation ProvidedImplementation for LysE
SDS-PAGEBasic purity assessment, molecular weight confirmationExpected MW: ~26 kDa for LysE (236 amino acids) , may migrate aberrantly as common for membrane proteins
Western blottingSpecific identification, detection of degradation productsUse antibodies against LysE or affinity tags (e.g., anti-His)
Mass spectrometryPrecise mass, verification of sequence, PTMsIntact mass measurement and peptide mapping after digestion
Size-exclusion chromatographyHomogeneity, aggregation assessment, oligomeric stateShould show monodisperse peak at expected elution volume
SEC-MALSAbsolute molecular weight, detection of detergent contributionDistinguishes protein from associated detergent/lipids
  • Structural Integrity Evaluation:

    • Circular dichroism spectroscopy to verify secondary structure content

    • Intrinsic fluorescence to assess tertiary structure integrity

    • Thermal stability assays (nanoDSF, CPM) to measure protein stability

  • Functional Verification:

    • Binding assays with L-lysine (e.g., microscale thermophoresis)

    • Transport assays after reconstitution into liposomes

    • ATPase assays if transport is energy-dependent

  • Critical Quality Attributes to Monitor:

    • Monodispersity (by SEC): >90% in main peak

    • Purity (by SDS-PAGE): >95% for structural studies, >85% for functional studies

    • Activity retention: >50% of predicted/theoretical activity

    • Stability: Minimal degradation after 24-48 hours at 4°C

  • Documentation and Reproducibility:

    • Develop standardized quality control workflows

    • Track batch-to-batch variation in critical attributes

    • Include quality control checkpoints at each purification stage

These analytical methods should be applied throughout the purification process, with particular attention after final purification steps. For LysE, with its 6-TMS topology , verifying proper folding in detergent is particularly important, as membrane proteins can appear pure on SDS-PAGE while being structurally compromised or aggregated in solution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.