Recombinant Lysinibacillus sphaericus Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mscL; Bsph_3396; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Lysinibacillus sphaericus (strain C3-41)
Target Names
mscL
Target Protein Sequence
MWKDFKEFAMKGNIIDLAVAVVIGGAFGKIVTSLVENIIMPLVGVLTGGIDLTASFVYGS GDAQIKLGVFLQSIIDFLIIAFAIFMALRIMTKLTNKKEEAVVEEPTPELDAKEELLKEI RDLLKKEQA
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane lipid bilayer stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the structural and functional significance of the MscL N-terminal domain in Lysinibacillus sphaericus?

The N-terminal domain of MscL plays a crucial role in mechanosensory transduction. Research indicates that this amphipathic helix serves as an essential structural element during tension-induced gating. Specifically, it both stabilizes the channel's closed state and facilitates coupling between the channel and the membrane .

Experimental evidence suggests that the N-terminal helix interacts with the TM2 helix of neighboring subunits, defining the conformational freedom of these helices and contributing to force transmission from the lipid bilayer to the channel pore . When membrane tension increases, the N-terminal helix begins to align with TM1 as a contiguous helix in the open state, indicating its role in the conformational changes associated with channel gating.

Finite element models demonstrate that deletion of the N-terminus results in significantly reduced sensitivity to applied membrane tension, as evidenced by reduced pore expansion . This supports the hypothesis that the N-terminal helix functions as an essential mechanosensing entity within the MscL structure.

How do environmental factors affect the stability and function of recombinant L. sphaericus MscL?

Recombinant L. sphaericus MscL function is significantly influenced by environmental conditions, particularly pH, temperature, and ionic composition. Given that L. sphaericus is alkaliphilic , the functional properties of its MscL channels are optimized in alkaline environments.

Metal ions have demonstrated effects on L. sphaericus cellular functions. Research has shown that various strains of L. sphaericus maintain functionality in the presence of heavy metals including cadmium, lead, chromium, and arsenic . By extension, recombinant MscL likely retains function in these conditions, though with potential modifications to gating kinetics.

Temperature sensitivity follows patterns typical of mesophilic bacteria, with optimal activity around 30°C, the standard incubation temperature used for L. sphaericus culture . Thermal stability studies would be recommended when characterizing recombinant MscL channels.

What are the optimal conditions for heterologous expression of L. sphaericus MscL?

For effective heterologous expression of L. sphaericus MscL, a methodical approach based on established protocols for membrane protein expression should be followed:

Expression System Selection:

  • E. coli BL21(DE3) for standard expression

  • C41(DE3) or C43(DE3) strains for toxic membrane proteins

  • Cell-free systems for proteins that may disrupt host cell membranes

Expression Conditions Table:

ParameterRecommended RangeOptimization Notes
Temperature18-30°CLower temperatures (18-20°C) often yield higher amounts of correctly folded protein
Induction0.1-0.5 mM IPTGGradual induction with lower IPTG concentrations improves folding
MediaLB or TB supplemented with glycerolAddition of glycerol (0.5-1%) stabilizes membrane proteins
Expression time4-18 hoursLonger times at lower temperatures increase yield of functional protein
Membrane mimeticsDDM, LDAO, or nanodiscsShould be introduced during or shortly after expression

Medium 295 broth, which has been successfully used for culturing L. sphaericus , may provide essential elements for proper folding when added as a supplement to standard expression media.

What purification strategies yield functionally active L. sphaericus MscL?

Purification of functionally active L. sphaericus MscL requires maintaining the protein in membrane-mimetic environments throughout the process:

  • Initial Extraction:

    • Solubilize membranes using mild detergents (DDM at 1-2%)

    • Include protease inhibitors and reducing agents

    • Perform at 4°C to minimize protein denaturation

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography using His-tagged constructs

    • Cobalt resins often provide higher purity than nickel for membrane proteins

    • Gradual imidazole gradient (20-300 mM) for elution

  • Size Exclusion Chromatography:

    • Critical for removing aggregates and ensuring homogeneity

    • Buffer containing 0.05% DDM or other suitable detergent

    • Assessment of pentameric assembly state

  • Functional Verification:

    • Patch-clamp electrophysiology of reconstituted channels

    • Fluorescence-based liposome assays for mechanosensitive gating

    • Circular dichroism to confirm secondary structure integrity

The purification should yield pentameric channel assemblies, as MscL functions as a homopentamer . Protein purity and assembly state should be verified through SDS-PAGE and BN-PAGE analysis respectively.

How does the G14 position in MscL affect channel function, and what methods can be used to analyze its role?

The G14 position serves as a critical hinge that positions the N-terminal helix parallel to the membrane plane at the bilayer-solvent interface. Research has shown that deletion of G14 results in a "leaky" phenotype with continuous spontaneous activity at subconducting levels .

Methodological approach to investigate G14 function:

  • Site-directed mutagenesis to substitute G14 with residues of varying flexibility and hydrophobicity

  • Patch-clamp analysis to measure gating parameters (pressure threshold, conductance, open probability)

  • Molecular dynamics simulations to visualize changes in N-terminal orientation and interactions

  • In vivo osmotic shock assays to correlate mutations with physiological function

Studies demonstrate that replacing G14 with less flexible residues restricts the mechanical coupling between the N-terminus and TM1, affecting channel gating. Specifically, the flexible nature of glycine at this position allows the N-terminal domain to respond to changes in membrane tension and transmit these forces to the pore-lining TM1 helices .

What is the role of TM2-N-terminus interactions in MscL function?

EPR and MD simulation data reveal essential interactions between the N-terminus and the TM2 helix of both adjacent and second neighbor (i+2) subunits . These interactions define the conformational freedom of the TM2 helix and are crucial for proper channel function.

The mechanistic model suggests:

  • Membrane tension is transmitted to the MscL pore-lining TM1 helices via the N-terminus

  • The amphipathic N-terminal helix guides the tilting and movement of the five TM1 helices in a coordinated manner

  • Conformational rearrangement establishes continuity between the N-terminus and TM1

  • This allows radial force on the N-terminus to be transduced into increased TM1 helix tilt relative to the membrane

Disruption of these TM2-N-terminus interactions through mutagenesis results in altered gating properties, suggesting their importance in stabilizing the closed state and facilitating the transition to the open state .

What electrophysiological methods are most effective for characterizing recombinant L. sphaericus MscL?

Electrophysiological characterization of L. sphaericus MscL can be conducted using several complementary approaches:

Patch-clamp techniques:

  • Spheroplast patch-clamp: Direct recording from bacterial membranes expressing MscL

  • Giant proteoliposome patch-clamp: Recording from reconstituted channels in defined lipid environments

  • Planar lipid bilayer recordings: For single-channel analysis in controlled membrane compositions

Key parameters to measure:

  • Pressure threshold for activation

  • Single-channel conductance (expected to be ~3 nS in standard conditions)

  • Subconductance states

  • Transition kinetics between open and closed states

  • Ion selectivity (typically minimal for MscL channels)

Data analysis should include:

  • Amplitude histograms to identify conductance states

  • Dwell time analysis for kinetic parameters

  • Boltzmann function fitting to determine sensitivity to membrane tension

When comparing wildtype and mutant channels, normalize tension activation thresholds to MscS channels (if co-expressed) to account for variation in membrane properties between preparations.

How can researchers overcome challenges in achieving functional reconstitution of recombinant MscL?

Functional reconstitution of MscL channels presents several challenges that can be addressed through systematic optimization:

  • Lipid composition optimization:

    • Test various PC:PE:PG ratios to mimic bacterial membrane composition

    • Include ~10% negatively charged lipids (e.g., PG) to stabilize the channel

    • Adjust membrane thickness by varying acyl chain length (C16-C18 typically optimal)

  • Reconstitution method selection:

    • Detergent-mediated reconstitution: Gentle removal of detergent using Bio-Beads or dialysis

    • Direct incorporation: Addition of channels during liposome formation

    • Fusion method: Incorporation of proteoliposomes into preformed membranes

  • Common issues and solutions:

ProblemPotential CauseSolution
No channel activityImproper orientationUse asymmetric reconstitution methods
Excessive spontaneous activityDestabilization during purificationAdd stabilizing lipids during purification
Loss of tension sensitivityDenatured N-terminal domainMaintain reducing environment, optimize detergent
Poor incorporation efficiencyIncompatible lipidsAdjust lipid composition to match source organism
Variable pressure thresholdsInconsistent membrane curvatureStandardize liposome size using extrusion
  • Verification methods:

    • Freeze-fracture electron microscopy to confirm channel incorporation

    • Fluorescence-based assays using calcein-loaded liposomes to test function

    • Cryo-EM analysis of reconstituted channels to verify structural integrity

How can the dual properties of L. sphaericus be leveraged in designing MscL-based biosensors?

L. sphaericus possesses dual beneficial properties for environmental applications, specifically in heavy metal bioremediation and mosquito larvicidal activity . These properties can be integrated with MscL channel engineering to create advanced biosensors:

MscL-based heavy metal biosensors:

  • Engineer MscL channels with metal-binding sites at the N-terminus or periplasmic loops

  • The binding of heavy metals (Cd, Pb, Cr, As) would induce conformational changes affecting channel gating

  • Couple channel opening to fluorescent or electrical readouts

  • Leverage L. sphaericus' natural heavy metal tolerance mechanisms

Design considerations:

  • Incorporate metal-responsive elements from S-layer proteins of L. sphaericus

  • Engineer chimeric proteins combining MscL's mechanosensitivity with metal-binding domains

  • Design reporter systems that respond to channel opening (e.g., fluorescent dye release)

Research has shown that L. sphaericus strains III(3)7, OT4b.31, and CBAM5 maintain functionality in environments polluted with arsenic, lead, hexavalent chromium, and cadmium , suggesting molecular adaptations that could be incorporated into MscL-based biosensor designs.

What are the methodological approaches for investigating the role of MscL in L. sphaericus environmental adaptation?

To investigate MscL's role in L. sphaericus environmental adaptation, particularly in heavy metal contaminated environments, several methodological approaches can be employed:

  • Comparative genomics and expression analysis:

    • Compare MscL sequences from L. sphaericus strains with varying environmental tolerances

    • Analyze MscL expression levels under different environmental stresses using RT-qPCR

    • Perform RNA-seq to identify co-expressed genes in response to osmotic and metal stresses

  • Knock-out and complementation studies:

    • Generate MscL knock-out strains of L. sphaericus

    • Assess survival rates under osmotic shock and heavy metal exposure

    • Complement with wild-type and modified MscL variants

    • Measure growth rates and survival in challenging environments

  • Structural studies with environmental variables:

    • Perform EPR spectroscopy of reconstituted MscL in the presence of varying metal concentrations

    • Utilize fluorescence resonance energy transfer (FRET) to measure conformational changes

    • Conduct molecular dynamics simulations in membranes of varying compositions

  • Physiological assessments:

    • Monitor cell volume regulation capabilities in hypoosmotic environments

    • Measure membrane potential changes in response to metal exposure

    • Assess correlations between MscL function and metal adsorption capabilities

L. sphaericus has demonstrated effective larvicidal performance in the presence of various metals and co-ions, suggesting that its membrane proteins, including MscL, may have evolved mechanisms to maintain function in contaminated environments . Understanding these adaptations could provide insights into designing stress-resistant membrane proteins for biotechnological applications.

How might recombinant L. sphaericus MscL contribute to biomaterial development?

L. sphaericus has been successfully used in surface treatment of construction materials for microbially-induced calcium carbonate precipitation (MICP), which reduces fluid ingress and heals micro-cracks . Integrating recombinant MscL channels into this application offers novel biomaterial possibilities:

Potential applications in smart biomaterials:

  • Stress-responsive self-healing materials incorporating MscL in liposomes

  • Controlled release systems triggered by mechanical deformation

  • Bio-responsive interfaces that alter permeability under specific mechanical conditions

Methodology for biomaterial integration:

  • Encapsulate MscL-containing proteoliposomes within construction materials

  • Design systems where channel opening triggers calcium precipitation pathways

  • Create composite materials with embedded MscL-functionalized vesicles containing healing agents

Research has shown that repeated treatment cycles of L. sphaericus in the presence of calcium sources result in more extensive and even coating of CaCO₃ crystals on material surfaces . This natural calcium-handling property could be coupled with MscL's mechanosensitivity to create materials that automatically heal in response to mechanical damage.

What techniques are available for studying the interaction between MscL and the S-layer proteins in L. sphaericus?

S-layer proteins in L. sphaericus play important roles in both mosquito larvicidal activity and potentially in metal resistance . Investigating their interaction with MscL requires specialized techniques:

Interaction analysis methods:

  • Co-immunoprecipitation with antibodies specific to MscL and S-layer proteins

  • Förster resonance energy transfer (FRET) between labeled MscL and S-layer proteins

  • Surface plasmon resonance (SPR) to measure binding kinetics

  • Crosslinking mass spectrometry to identify interaction interfaces

  • Atomic force microscopy (AFM) to visualize potential co-localization in native membranes

Functional impact assessment:

  • Design chimeric constructs combining domains from MscL and S-layer proteins

  • Perform electrophysiological analyses in the presence and absence of purified S-layer proteins

  • Measure changes in larvicidal activity when MscL is overexpressed or deleted

The difference in larvicidal activity in chromium-containing environments for different L. sphaericus strains has been linked to S-layer proteins . This suggests potential interaction or functional relationship between membrane proteins (possibly including MscL) and S-layer components that could be exploited for biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.