Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY (bioY)

Shipped with Ice Packs
In Stock

Description

Protein Architecture

  • Gene: bioY (UniProt ID: P22819) .

  • Amino Acid Sequence: Comprises residues 1–196, with predicted transmembrane domains critical for biotin transport .

  • Molecular Weight: ~22–24 kDa (calculated based on partial sequence data) .

Mechanism of Action

BioY functions as a solitary transporter, independent of auxiliary subunits like T units, to mediate biotin import across cytoplasmic membranes. This distinguishes it from canonical Energy-Coupling Factor (ECF) transporters, which typically require ATPase components .

Expression Systems

  • Yeast: Widely used for recombinant production, yielding >85% purity via affinity chromatography .

  • Storage: Stable in Tris-based buffer with 50% glycerol at -20°C or -80°C .

Key Parameters

ParameterDetails
Expression HostSaccharomyces cerevisiae (Yeast)
Purity>85% (SDS-PAGE verified)
Storage BufferTris-based, 50% glycerol
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL)

Functional Validation

  • Biotin Transport Assays: Recombinant BioY restored biotin uptake in E. coli mutants deficient in endogenous transporters, confirmed via [³H]biotin uptake and growth assays .

  • Solitary Activity: BioY operates without T units, a unique feature among ECF transporters .

Applications in Biotechnology

  • Metabolic Engineering: Potential use in microbial chassis for biotin overproduction.

  • Drug Delivery: Explored as a target for antimicrobial agents due to biotin dependency in pathogens .

BioY vs. Canonical ECF Transporters

FeatureBioYCanonical ECF Transporters
Subunit RequirementSolitary (no T unit)Requires S, T, and ATPase units
Biotin AffinityHigh (nM range)Variable
Host CompatibilityFunctional in E. coliLimited to native hosts

Challenges and Future Directions

  • Structural Resolution: Full-length crystal structure remains undetermined, limiting mechanistic insights .

  • Optimization: Enhancing expression yields in industrial hosts (e.g., Bacillus subtilis) for large-scale applications .

References

  1. Solitary BioY proteins mediate biotin transport into ... - PubMed .

  2. Contribution of S-Layer Proteins to the Mosquitocidal Activity ... .

  3. ELISA Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY .

  4. Recombinant Lysinibacillus sphaericus Probable biotin transporter BioY (bioY) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
bioY; Probable biotin transporter BioY
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
full length protein
Species
Lysinibacillus sphaericus (Bacillus sphaericus)
Target Names
bioY
Target Protein Sequence
MLKQQSTLSLVMIAMFAALTAVGAFIKIPLPLVPFTLQIVFVFLAGCLLGGRNGFQSQLV YIGIGLVGLPVFTQGGGITYVLQPTFGYLIGFALAALVIGYMIDRVESPTKKHFIVANII GLIIIYAVAVPYLYVALNVWLNMKSSWSHVFLVGFVNSIVADFCLAIASALLAERLYKVF RSARAIKLVQIEKENV
Uniprot No.

Target Background

Function
This protein is a probable biotin transporter.
Protein Families
BioY family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Lysinibacillus sphaericus and what makes it scientifically significant?

Lysinibacillus sphaericus is a gram-positive bacterium that was previously classified as Bacillus sphaericus before being reassigned to the genus Lysinibacillus. The cell wall peptidoglycan of Lysinibacillus is characterized by the presence of aspartic acid, known as Lysine A4a (Lys-Asp) type .

The scientific significance of L. sphaericus stems from its diverse applications across multiple fields. It has been identified as a promising microbe for lithium nanoparticle extraction and the production of lithium hydroxide through biomineralization processes, offering potential for environmentally friendly lithium extraction techniques . Additionally, L. sphaericus exhibits strong insecticidal properties against mosquito larvae, including those that transmit diseases like malaria (Anopheles gambiae) and arboviruses like Zika and dengue (Aedes aegypti) .

Beyond these applications, L. sphaericus demonstrates antimicrobial potential against various pathogens including Staphylococcus aureus, Escherichia coli, and Bacillus subtilis, with some strains producing antimicrobial proteins and compounds effective against both bacterial and fungal pathogens .

What is the BioY protein and what role does it play in Lysinibacillus sphaericus?

The BioY protein in Lysinibacillus sphaericus functions as a probable biotin transporter. BioY belongs to a larger family of proteins that form part of Energy-coupling factor (ECF) transporters, which constitute a significant group of vitamin uptake systems in prokaryotes .

In the context of ECF transporters, BioY serves as a substrate-specific transmembrane S unit specifically designed for biotin transport. These ECF transporters typically comprise three components: diverse substrate-specific transmembrane proteins (S units, such as BioY), a ubiquitous transmembrane protein (T unit), and homo- or hetero-oligomeric ABC ATPases that provide energy for transport .

What makes BioY particularly interesting is that while most biotin-specific S units (BioY proteins) interact with T units and ABC ATPases, approximately one-third of BioY proteins are encoded in organisms that lack recognizable T units. This suggests that these "solitary" BioY proteins may function independently as transporters without the typical associated ECF transporter components, representing a unique case among vitamin transporters .

The full amino acid sequence of L. sphaericus BioY consists of 196 amino acids, with the sequence: mLKQQSTLSLVMIAMFAALTAVGAFIKIPLPLVPFTLQIVFVFLAGCLLGGRNGFQSQLVYIGIGLVGLPVFTQGGGITYVLQPTFGYLIGFALAALVIGYMIDRVESPTKKHFIVANIIGLIIIYAVAVPYLYVALNVWLNMKSSWSHVFLVGFVNSIVADFCLAIASALLAERLYKVFRSARAIKLVQIEKENV .

What are the structural characteristics of the BioY protein in L. sphaericus?

The BioY protein from Lysinibacillus sphaericus is a transmembrane protein consisting of 196 amino acids. Analysis of its amino acid sequence reveals characteristics typical of membrane transport proteins .

The protein's hydrophobicity profile indicates multiple transmembrane domains, consistent with its function as a transporter embedded in the cell membrane. These hydrophobic regions are interspersed with charged residues that likely participate in substrate recognition and binding.

The structure of BioY includes:

  • A predominantly hydrophobic composition suitable for membrane insertion

  • Regions rich in glycine and alanine that contribute to structural flexibility

  • Charged amino acid clusters potentially involved in biotin recognition

  • Conserved motifs common to S-components of ECF transporters

While detailed crystallographic structures specifically for L. sphaericus BioY are not available in the provided search results, comparative analysis with related proteins suggests a compact fold with six transmembrane segments, where biotin binding likely occurs within a pocket formed by these segments.

How can researchers effectively express and purify recombinant L. sphaericus BioY protein for structural and functional studies?

Expression and purification of recombinant L. sphaericus BioY presents several challenges due to its transmembrane nature. Based on methodologies employed for similar membrane proteins, researchers should consider the following approach:

Expression System Selection:
Escherichia coli is a suitable heterologous host for BioY expression, particularly given successful precedents in expressing solitary BioY proteins in E. coli strains . The K-12 derivative strains deficient in endogenous biotin transport systems are especially valuable for functional studies as they provide a clean background for assessing BioY activity.

Expression Vector Design:

  • Include a codon-optimized sequence of the L. sphaericus bioY gene

  • Incorporate an affinity tag (His6 or Strep-tag) for purification

  • Consider using an inducible promoter system (T7 or araBAD) to control expression levels

  • Include a cleavable linker between the tag and protein if tag-free protein is required for functional studies

Membrane Protein Expression Protocol:

  • Transform expression plasmid into E. coli BL21(DE3) or C41/C43(DE3) strains optimized for membrane protein expression

  • Culture cells at lower temperatures (18-25°C) after induction to minimize inclusion body formation

  • Use lower inducer concentrations to prevent toxicity associated with membrane protein overexpression

  • Supplement media with biotin at concentrations that won't inhibit BioY expression but will support cell growth

Purification Strategy:

  • Harvest cells and disrupt by sonication or pressure-based methods

  • Isolate membrane fraction through differential centrifugation

  • Solubilize membranes using mild detergents (DDM, LMNG, or digitonin)

  • Perform affinity chromatography using the incorporated tag

  • Consider size exclusion chromatography as a polishing step

  • Assess protein purity using SDS-PAGE and protein functionality through biotin binding assays

This methodology has been successfully applied to related membrane transporters and can be adapted specifically for L. sphaericus BioY to yield functionally active protein for subsequent studies.

What experimental approaches can be used to investigate whether the L. sphaericus BioY functions as a solitary transporter?

Investigating the solitary transporter functionality of L. sphaericus BioY requires multiple complementary approaches:

Genetic Complementation Assays:
Following the methodology demonstrated in search result , researchers can:

  • Construct an E. coli reference strain with deficiencies in both biotin synthesis and endogenous biotin transport

  • Express the solitary L. sphaericus bioY gene in this strain

  • Assess growth on media containing trace biotin levels

  • Compare growth with positive controls (known biotin transporters) and negative controls (empty vector)

Successful growth restoration would provide strong evidence for solitary transport activity.

Transport Assays with Radiolabeled or Fluorescently-Tagged Biotin:

  • Express BioY in proteoliposomes or whole cells lacking endogenous biotin transport

  • Incubate with labeled biotin at various concentrations

  • Measure uptake kinetics through rapid filtration or fluorescence detection

  • Perform competition assays with unlabeled biotin to determine specificity

Electrophysiological Studies:

  • Reconstitute purified BioY in planar lipid bilayers or patch-clamp whole cells expressing BioY

  • Measure electrical currents associated with biotin transport

  • Determine ion coupling and electrogenicity of transport

Structural Studies with and without Substrate:

  • Perform crystallography or cryo-EM studies of purified BioY

  • Compare structures with and without bound biotin

  • Identify conformational changes associated with substrate binding and transport

Interaction Studies:

  • Use pull-down assays, crosslinking, or surface plasmon resonance to evaluate potential interactions with other cellular components

  • Perform co-immunoprecipitation experiments to identify interacting partners in vivo

By combining these approaches, researchers can build a comprehensive understanding of whether and how L. sphaericus BioY functions independently of traditional ECF transporter components, potentially revealing novel transport mechanisms.

How does the transport mechanism of solitary BioY proteins differ from complete ECF transporter complexes?

The transport mechanism of solitary BioY proteins represents a fascinating deviation from the canonical ECF transporter complexes, presenting important mechanistic questions:

Energetic Considerations:
In complete ECF transporters, the ABC ATPases provide energy through ATP hydrolysis to drive conformational changes in the T unit, which then alters the orientation of the S unit (BioY) to release substrate into the cytoplasm . Solitary BioY proteins lack these energy-coupling components, raising questions about their energetics:

  • Potential Mechanisms:

    • Facilitated diffusion (concentration-dependent, non-energy requiring)

    • Proton or ion coupling (using electrochemical gradients)

    • Interaction with alternative energy-coupling proteins not recognized as typical ECF components

  • Experimental Evidence:
    Research with solitary BioY proteins expressed in E. coli demonstrates their ability to mediate biotin transport even in the absence of canonical T units and ABC ATPases . This suggests either an intrinsic transport capability or interaction with host components that can partially substitute for the missing ECF elements.

Structural Adaptations:
Solitary BioY proteins likely possess structural adaptations that enable substrate transport without the conformational coupling normally provided by T units:

  • Hypothesized Differences:

    • More flexible transmembrane domains allowing conformational changes without T unit interaction

    • Modified substrate-binding site architecture that permits release without major protein reorientation

    • Potential oligomerization that provides additional functional capabilities

Kinetic and Affinity Properties:
The transport characteristics of solitary BioY likely differ from complete ECF systems:

  • Expected Differences:

    • Lower transport rates due to absence of ATP-driven conformational changes

    • Potentially higher substrate affinity to enable efficient capture at low concentrations

    • Possible substrate concentration thresholds for transport functionality

Understanding these mechanistic differences provides crucial insights into the evolution of transport systems and may reveal novel transport principles that could inform the design of synthetic transporters or drug delivery systems.

What protocols are most effective for studying the biomineralization capabilities of L. sphaericus in lithium extraction applications?

For researchers investigating L. sphaericus as a potential tool for lithium extraction through biomineralization, the following methodological approach is recommended based on established protocols :

Bacterial Culture and Biomineralization Induction:

  • Cultivate L. sphaericus in standard LB medium until mid-log phase

  • Harvest cells by centrifugation at 3000 g for 10 minutes

  • Discard supernatant and resuspend cell pellet in M9 minimal media containing:

    • 2 mM magnesium sulfate

    • 0.1 mM calcium chloride

    • 48 mM sodium phosphate dibasic

    • 22 mM monopotassium phosphate

    • 9 mM sodium chloride

    • 20 mM ammonium chloride

  • Supplement media with 170 mM lithium chloride

  • For selectivity studies, add sodium chloride to simulate co-occurrence in salt brines

  • Incubate the culture at 37°C with shaking for 48 hours

Lithium Quantification Procedure:

  • Transfer the 48-hour culture to 50 mL centrifuge tubes

  • Centrifuge at 10,000 g for 30 minutes

  • Discard supernatant and dry the cell pellet

  • Resuspend pellet in 200 μL acetonitrile

  • Prepare a stock solution containing:

    • 1 mM triethylamine

    • 4 mM 2-(2-hydroxyphenyl)-benzoxazole in acetonitrile

  • Create a standard curve with lithium chloride concentrations from 0 to 0.1 μmol

  • Measure fluorescence at 392 nm excitation and 428 nm emission

  • Generate a standard curve with linear regression

  • For sample analysis, combine 5 μL of sample with 145 μL of stock solution

  • Measure fluorescence and calculate lithium content using the standard curve equation

Nanoparticle Characterization:

  • Analyze biomineralized lithium using:

    • Fourier transform infrared spectroscopy to identify chemical bonds

    • Transmission electron microscopy to determine nanoparticle size, morphology, and crystallinity

  • Compare results with control samples (lithium salts without bacteria)

Protein Component Analysis:
To investigate the role of specific bacterial proteins in lithium biomineralization:

  • Isolate bacterial ghost cells following the protocol detailed in search result

  • Verify ghost isolation through SDS-PAGE (molecular weight ~122 kDa for S-layer protein)

  • Perform protein identification using LC-MS/MS

  • Process mass spectrometry data using Proteome Discoverer 3.0 with a Lysinibacillus database

This comprehensive approach allows for quantitative assessment of lithium recovery, determination of selectivity over other ions, characterization of the biomineralized products, and identification of the bacterial components responsible for the biomineralization process.

How can researchers effectively evaluate the potential interactions between BioY and S-layer proteins in L. sphaericus?

Given the demonstrated role of S-layer proteins in L. sphaericus biomineralization processes and the membrane-associated nature of BioY, investigating potential functional or structural interactions between these proteins requires specialized methodologies:

Co-localization Studies:

  • Fluorescence Microscopy Approach:

    • Generate fusion constructs of BioY and S-layer proteins with different fluorescent tags (e.g., GFP for BioY, mCherry for S-layer)

    • Express constructs in L. sphaericus or a heterologous host

    • Visualize cellular distribution using confocal microscopy

    • Quantify co-localization using Pearson's correlation coefficient

  • Immunogold Electron Microscopy:

    • Prepare bacterial cells or ghost preparations

    • Label BioY and S-layer proteins with antibodies conjugated to gold particles of different sizes

    • Examine sections with transmission electron microscopy

    • Analyze spatial relationships at nanometer resolution

Physical Interaction Analysis:

  • Co-immunoprecipitation:

    • Generate antibodies against BioY and S-layer proteins

    • Prepare membrane fractions under mild solubilization conditions

    • Perform pull-down experiments with either antibody

    • Analyze precipitated complexes by Western blot or mass spectrometry

  • Crosslinking Studies:

    • Treat intact cells with membrane-permeable crosslinkers of various arm lengths

    • Isolate membrane fractions

    • Identify crosslinked complexes through diagonal SDS-PAGE or mass spectrometry

    • Verify specific interactions through controls with non-interacting membrane proteins

  • Bimolecular Fluorescence Complementation:

    • Split a fluorescent protein into N- and C-terminal fragments

    • Fuse these fragments to BioY and S-layer proteins

    • Express in cells and monitor for fluorescence reconstitution, indicating proximity

Functional Relationship Studies:

  • Genetic Approaches:

    • Generate knockout or knockdown strains for bioY and S-layer genes

    • Assess the impact on biotin transport and biomineralization capabilities

    • Perform complementation studies with wild-type and mutant versions

  • Transport Assays with Purified Components:

    • Reconstitute purified BioY in liposomes with and without S-layer proteins

    • Measure biotin transport activity under various conditions

    • Determine if S-layer proteins modulate BioY transport function

Structural Studies:

  • Native Mass Spectrometry:

    • Isolate membrane complexes under native conditions

    • Analyze by native MS to determine complex composition

    • Identify stable subcomplexes and interaction stoichiometry

By employing these complementary approaches, researchers can characterize the spatial, physical, and functional relationships between BioY transporters and S-layer proteins in L. sphaericus, potentially revealing novel insights into how membrane transport systems interact with structural components of the bacterial cell envelope.

What are the key considerations for designing experiments to evaluate the biotin transport kinetics of L. sphaericus BioY in different membrane environments?

Investigating biotin transport kinetics of L. sphaericus BioY across various membrane environments requires careful experimental design to account for multiple variables affecting transporter function:

Experimental Systems Selection:

  • Whole Cell Systems:

    • E. coli biotin transport-deficient strains as described in

    • L. sphaericus native cells (wild-type vs. bioY knockout)

    • Other heterologous expression hosts with different membrane compositions

  • Reconstituted Systems:

    • Proteoliposomes with defined lipid compositions

    • Nanodiscs for single-transporter studies

    • Planar lipid bilayers for electrophysiological measurements

Key Parameters to Measure:

ParameterMeasurement TechniqueExpected RangeSignificance
Km (Michaelis constant)Transport assays with varying biotin concentrations1-100 nMIndicates substrate affinity
VmaxTransport assays at saturating biotin concentrations0.1-10 pmol/min/mg proteinReflects maximum transport capacity
Transport specificityCompetition assays with biotin analogsIC50 valuesDetermines substrate selectivity
Temperature dependenceAssays at 4-45°CQ10 ~2-3Provides thermodynamic parameters
pH dependenceAssays at pH 5.5-9.0Optimal pH ~7-8Indicates potential proton coupling
Ion dependenceAssays with varying ion compositionsStimulation or inhibitionIdentifies potential ion coupling

Methodological Approach:

  • For Whole Cell Transport Studies:

    • Express BioY in appropriate host cells

    • Wash cells and resuspend in transport buffer

    • Add radiolabeled or fluorescently-tagged biotin at various concentrations

    • Incubate for defined time periods at controlled temperature

    • Terminate transport by rapid filtration and washing

    • Measure accumulated biotin by scintillation counting or fluorescence

  • For Proteoliposome Studies:

    • Purify BioY protein as outlined in question 2.1

    • Reconstitute into liposomes of defined composition

    • Remove external substrate through gel filtration

    • Initiate transport by adding labeled biotin

    • Filter liposomes at various time points

    • Quantify internal substrate accumulation

  • For Nanodisc Studies:

    • Assemble BioY into nanodiscs with membrane scaffold proteins

    • Immobilize on sensor chips

    • Measure binding kinetics using surface plasmon resonance

    • Determine association and dissociation rates for biotin

Membrane Composition Variables:

  • Lipid Head Group Composition:

    • Phosphatidylethanolamine (PE)

    • Phosphatidylglycerol (PG)

    • Cardiolipin (CL)

    • Phosphatidylcholine (PC)

  • Fatty Acid Composition:

    • Chain length (C14-C22)

    • Saturation level

    • Branched vs. straight chains

  • Membrane Fluidity Modulators:

    • Cholesterol or hopanoids

    • Temperature variation

    • Fluidizing or rigidifying agents

  • Membrane Potential:

    • Establish ion gradients across membranes

    • Apply valinomycin/K+ to generate potentials

    • Measure transport with and without membrane potential

By systematically varying these parameters, researchers can determine how membrane environment influences the kinetic properties of L. sphaericus BioY, potentially revealing mechanisms of transport regulation and environmental adaptation that might be exploited in biotechnological applications.

How should researchers interpret contradictory findings regarding the function of solitary BioY proteins?

When confronted with contradictory findings regarding solitary BioY protein function, researchers should implement a systematic analysis framework:

Methodological Reconciliation Approach:

  • System-Dependent Variables Analysis:

    • Compare experimental systems (heterologous hosts vs. native expression)

    • Assess membrane composition differences between studies

    • Evaluate protein expression levels and potential artifacts from overexpression

    • Consider genetic background differences in test organisms

  • Functional Definition Assessment:

    • Clarify how "transport" is defined in each study (binding vs. translocation)

    • Compare sensitivity of detection methods (radiolabeling vs. growth assays)

    • Distinguish between high-affinity transport and facilitated diffusion

  • Statistical and Reproducibility Evaluation:

    • Reassess statistical significance across contradictory studies

    • Consider sample sizes and biological/technical replicates

    • Implement meta-analysis techniques when multiple datasets exist

Potential Sources of Contradictions:

  • BioY Heterogeneity:
    Different BioY proteins, even with high sequence similarity, may possess distinct functional properties. For example, while approximately one-third of BioY proteins are encoded in organisms lacking recognizable T units , these proteins may have evolved different mechanisms for substrate translocation.

  • Cryptic Partners:
    Some experimental systems may contain unrecognized proteins that functionally substitute for canonical ECF components. The E. coli K-12 reference strain is particularly valuable because it lacks components of ECF transporters , but other systems might contain proteins that complement BioY function.

  • Experimental Conditions:
    Transport activity may be condition-dependent. Variables such as membrane potential, pH gradients, and ion concentrations may dramatically affect transport capabilities of solitary BioY proteins.

Decision Framework for Resolving Contradictions:

  • Design Critical Experiments:

    • Identify key discriminating experiments that directly address contradictory findings

    • Perform side-by-side comparisons of different BioY proteins under identical conditions

    • Implement genetic complementation with systematic domain swapping

  • Structural Analysis:

    • Compare structural elements between functionally distinct BioY proteins

    • Identify potential regions responsible for autonomous function

    • Implement site-directed mutagenesis of candidate residues

  • Evolutionary Context:

    • Perform phylogenetic analysis of BioY proteins

    • Correlate functional properties with evolutionary lineages

    • Assess genomic context and potential co-evolution with other components

By implementing this systematic approach to contradiction resolution, researchers can transform seemingly conflicting data into valuable insights about the functional diversity and mechanistic versatility of BioY transporters, potentially revealing fundamental principles of membrane transport evolution.

What are the most promising applications of engineered L. sphaericus BioY variants in research settings?

Engineered variants of L. sphaericus BioY offer numerous research applications spanning from basic science to applied biotechnology:

Biosensor Development:
BioY's high affinity for biotin makes it an excellent candidate for developing highly sensitive biotin detection systems. Engineered BioY variants could be developed by:

  • Fusion with fluorescent proteins that report conformational changes upon biotin binding

  • Integration into field-effect transistor (FET) platforms for electronic detection

  • Coupling with reporter enzymes for colorimetric or luminescent output

These biosensors would be valuable for measuring biotin in biological samples, environmental monitoring, and quality control in biotechnology.

Membrane Protein Engineering Platform:
The ability of solitary BioY to function independently makes it an excellent model system for studying fundamental principles of membrane protein engineering:

  • Structure-function relationships in minimal transporters

  • Protein design principles for creating artificial transporters

  • Testing hypotheses about transporter evolution and modularity

Targeted Drug Delivery Systems:
Modified BioY variants could serve as targeting modules for nanoparticle drug delivery systems:

  • Engineering substrate specificity to recognize disease biomarkers

  • Creating BioY-functionalized liposomes that target specific cell types

  • Developing BioY-based cell-penetrating delivery systems

Synthetic Biology Applications:
In synthetic biology, engineered BioY variants could enable:

  • Creation of synthetic cells with programmable nutrient uptake capabilities

  • Development of cellular resource allocation systems controlled by biotin availability

  • Design of cellular biosensors for monitoring metabolic states

Research Tools for Biomineralization Studies:
Given the biomineralization capabilities of L. sphaericus , engineered BioY-S-layer protein fusions could:

  • Enable studies of protein-directed mineralization processes

  • Create programmable biomineralization systems for nanomaterial synthesis

  • Develop selective recovery systems for valuable minerals beyond lithium

Methodological Advancements:
Strategic engineering of BioY proteins could advance research methodologies:

  • Development of membrane protein expression tags that enhance yield and stability

  • Creation of modular membrane protein assembly systems

  • Design of reporters for membrane protein folding and quality control

By pursuing these applications, researchers can both advance fundamental understanding of membrane transport and develop valuable tools and technologies with applications across biological and medical research.

How might the dual functionality of L. sphaericus in both biotin transport and biomineralization be leveraged for interdisciplinary research?

The dual functionality of L. sphaericus—encompassing both biotin transport through BioY protein and biomineralization capabilities through S-layer proteins —presents unique opportunities for interdisciplinary research spanning synthetic biology, materials science, and environmental biotechnology:

Engineered Cellular Systems for Controlled Biomineralization:

Researchers could develop systems where biomineralization activity is regulated by biotin availability:

  • Engineer L. sphaericus strains with modified BioY proteins that respond to specific signals

  • Create genetic circuits linking biotin transport to S-layer protein expression

  • Develop biotin-responsive promoters controlling genes involved in biomineralization

This approach would enable temporally controlled biomineralization for applications in materials science and bioremediation.

Biotin-Tagged Mineral Recovery Systems:

The high affinity of BioY for biotin could be exploited in mineral recovery applications:

  • Develop biotin-conjugated chelating agents for specific minerals

  • Express BioY on bacterial cell surfaces to capture the biotin-mineral complexes

  • Design recycling systems that release minerals under controlled conditions

This strategy could enhance the selectivity of L. sphaericus for valuable minerals beyond lithium .

Self-Assembling Bioresponsive Materials:

The integration of BioY and S-layer proteins could enable creation of smart materials:

  • Design recombinant proteins combining domains from BioY and S-layer proteins

  • Create self-assembling structures that change properties in response to biotin

  • Develop biomineralized materials with embedded biotin-responsive elements

These materials could find applications in biosensing, controlled release systems, and adaptive surfaces.

Dual-Function Environmental Remediation Systems:

Leveraging both functionalities could enhance bioremediation capabilities:

  • Design systems where biomineralization activity sequesters heavy metals

  • Use biotin transport to control cellular metabolism during remediation

  • Develop feedback mechanisms where detected contaminants trigger appropriate remediation responses

Evolutionary Studies on Functional Coupling:

The dual functionality presents opportunities to study how different cellular systems evolved:

  • Investigate potential co-evolution of transport and biomineralization systems

  • Examine whether metabolic dependencies exist between these functions

  • Explore how environment shapes the relationship between these capabilities

Bioinspired Materials Design:

Understanding the relationship between BioY and biomineralization could inform new materials:

  • Study how membrane organization influences mineral formation

  • Investigate energy coupling between transport and mineralization processes

  • Develop synthetic systems that mimic the spatial organization of these functions in L. sphaericus

By exploring these interdisciplinary directions, researchers can not only advance understanding of fundamental biological processes but also develop novel technologies addressing challenges in environmental remediation, materials science, and biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.