Recombinant Lysinibacillus sphaericus Protein BioX (bioX)

Shipped with Ice Packs
In Stock

Description

Introduction to Lysinibacillus sphaericus

Lysinibacillus sphaericus is a Gram-positive, spore-forming bacterium that has gained significant attention in scientific research due to its production of various proteins with biological activities. This bacterium is particularly known for producing proteins with pesticidal properties, especially against mosquito larvae that serve as vectors for human diseases . L. sphaericus strains, particularly those belonging to the antigenic group H5a5b, produce spores with larvicidal activity against Culex mosquitoes, making them valuable as biocontrol agents .

While much research has focused on the mosquitocidal proteins of L. sphaericus, such as the binary (Bin) toxins, Tpp49Aa1/Cry48Aa1 proteins, and S-layer proteins, the BioX protein represents another significant protein from this organism with distinct properties and potential applications . Understanding the structure, properties, and functions of BioX contributes to our broader knowledge of L. sphaericus and its biotechnological potential.

Production of Recombinant BioX

Recombinant production of Lysinibacillus sphaericus BioX has been successfully achieved using Escherichia coli as an expression host . This approach allows for controlled production and purification of the protein for research and potential commercial applications.

Expression Systems and Purification

The full-length BioX protein (amino acids 1-166) has been expressed in E. coli with an N-terminal histidine (His) tag . This His-tag facilitates protein purification through metal affinity chromatography, allowing researchers to selectively isolate BioX from other cellular proteins, resulting in high-purity preparations.

Commercial sources offer BioX in different forms. Both partial and full-length versions of recombinant BioX are available from suppliers such as MyBioSource.com (partial version, catalog MBS7060042) and Creative BioMart (full-length version, catalog RFL1892LF) . The full-length version encompasses the entire 166 amino acid sequence, while partial versions may include specific fragments of the protein.

Table 2: Recombinant BioX Production Characteristics

FeatureDescription
Expression SystemE. coli
Affinity TagN-terminal His tag
Available FormsFull-length (1-166 aa) and partial
Commercial SourcesCreative BioMart (RFL1892LF) , MyBioSource (MBS7060042)
Purity>90% as determined by SDS-PAGE

Physical and Biochemical Properties

The recombinant BioX protein is typically provided as a lyophilized powder, which offers stability during shipping and storage . According to available data, the purity of commercially available recombinant BioX is typically greater than 90%, as determined by SDS-PAGE (sodium dodecyl sulfate-polyacrylamide gel electrophoresis) .

Applications and Research Significance

Based on available information, one confirmed application for recombinant BioX is in SDS-PAGE analysis, suggesting its use in protein research, possibly as a standard or control in various biochemical assays . The broader applications and research significance of BioX must be considered in the context of other L. sphaericus proteins and ongoing research in this field.

Context within L. sphaericus Research

Proteins from L. sphaericus have garnered significant interest primarily due to their insecticidal properties . The organism produces various toxins effective against mosquito larvae, particularly of the Culex genus, which are vectors for human diseases . For instance, the binary toxins (BinA and BinB) and S-layer proteins from L. sphaericus have demonstrated larvicidal activity against mosquitoes .

The S-layer proteins from L. sphaericus have been shown to contribute to the bacterium's pathogenicity, with purified S-layer from L. sphaericus C7 strain being toxic against both Culex and Aedes aegypti larvae . In silico analyses of S-layer sequences have suggested the presence of chitin-binding and hemolytic domains, biochemical characteristics that may contribute to their pathogenicity .

Similarly, the Tpp49Aa1/Cry48Aa1 protein pair from L. sphaericus has been identified as a toxin that can overcome resistance to currently marketed bioinsecticides . These proteins are required as a pair to exert toxicity against mosquito vectors .

While BioX is not explicitly mentioned in the available research as having insecticidal activity, its study remains valuable for understanding the biology of L. sphaericus and its potential applications. The recombinant production of BioX enables detailed structural and functional studies, which could reveal novel applications or insights into the organism's biology.

Research Gaps and Future Directions

Despite the availability of recombinant BioX protein for research purposes, several knowledge gaps remain regarding its specific biological role, structure-function relationships, and potential applications. Future research directions may include:

  1. Detailed structural studies to determine the three-dimensional conformation of BioX and identify functional domains.

  2. Investigation of potential interactions between BioX and other proteins or cellular components.

  3. Exploration of any biological activities, including potential antimicrobial or insecticidal properties.

  4. Comparative studies with other proteins from L. sphaericus to understand evolutionary relationships and functional similarities or differences.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
bioX; Protein BioX
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-166
Protein Length
full length protein
Species
Lysinibacillus sphaericus (Bacillus sphaericus)
Target Names
bioX
Target Protein Sequence
MRKFSTYDLAQISLLACLIIVTGMFKIPTGIPGSEFQLSAPIAVAIAAVFGFKRYFLAGI IASLILFLLGIHSILNVEISIIFRLTVGLIIVLLGTSIPVLVVAGPIGTMVARLGLAFTL GTPFLPLFVLAIPGMVITAVSVYPITKMLYAINKKVAGDHHVRNVL
Uniprot No.

Target Background

Function

This protein does not appear to function as a pimelate permease. Its role in biotin synthesis remains unclear.

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the function of BioX in Lysinibacillus sphaericus?

BioX functions as an XRE-type regulator protein that acts as a negative transcriptional factor. Based on structural and functional analysis, BioX belongs to the xenobiotic response element (XRE) family of transcriptional regulators that typically contain a helix-turn-helix DNA-binding motif in their N-terminal domains . In biological systems, BioX appears to regulate gene expression by binding to specific DNA sequences in promoter regions, thereby controlling the transcription of target genes.

Similar to other XRE-type regulators, BioX likely responds to specific environmental or metabolic signals, resulting in conformational changes that alter its DNA-binding properties. This mechanism allows Lysinibacillus sphaericus to adapt to changing environmental conditions by modulating gene expression patterns.

What expression systems are commonly used for producing Recombinant Lysinibacillus sphaericus Protein BioX?

The expression of Recombinant Lysinibacillus sphaericus Protein BioX typically employs several expression systems, each with distinct advantages depending on research objectives:

Expression SystemAdvantagesConsiderationsTypical Yield
E. coli (BL21/DE3)High expression levels, rapid growth, economicalMay require codon optimization, potential inclusion body formation10-50 mg/L
Bacillus subtilisBetter folding of Gram-positive bacterial proteins, secretion capabilityLower expression levels compared to E. coli5-15 mg/L
Yeast (P. pastoris)Post-translational modifications, proper protein foldingLonger development time, complex media requirements20-100 mg/L

When selecting an expression system, researchers should consider that BioX, like other DNA-binding proteins, may be toxic to host cells when overexpressed. Inducible expression systems with tight regulation, such as IPTG-inducible T7 promoter systems in E. coli or methanol-inducible AOX1 promoter in P. pastoris, are recommended to control expression levels .

What are the common applications of BioX in microbiological research?

BioX has several research applications in microbiology and biotechnology:

  • Transcriptional regulation studies: BioX serves as a model for understanding bacterial gene regulation mechanisms, particularly in environmental adaptation.

  • Probiotic development: Understanding BioX function may help explain the mechanisms behind Lysinibacillus species' probiotic properties in aquaculture. Recent research has identified Lysinibacillus strains with strong inhibitory activity against pathogenic Vibrio species, demonstrating their potential as probiotics .

  • Biocontrol applications: Lysinibacillus sphaericus produces insecticidal proteins, and BioX may be involved in regulating these toxin genes, making it relevant for biocontrol research.

  • Biotechnological tools: As a DNA-binding protein, modified BioX variants could potentially be developed as molecular tools for gene regulation in synthetic biology applications.

What experimental design approaches are recommended for studying BioX protein activity?

When studying BioX protein activity, a comprehensive Design of Experiments (DoE) approach is highly recommended. DoE provides a systematic framework that maximizes information gained while minimizing required experiments .

Recommended DoE Strategy for BioX Activity Studies:

Experimental PhaseKey Factors to EvaluateAnalytical MethodsOutput Measurements
Protein ExpressionTemperature (20-37°C), Inducer concentration, Expression time (4-24h)SDS-PAGE, Western blotProtein yield, Solubility
DNA-Binding ActivitypH (6.0-8.5), Salt concentration (50-500mM), Temperature (4-37°C)EMSA, Fluorescence anisotropy, ChIP-seqBinding affinity (Kd), Specificity
Transcriptional RegulationLigand presence, Concentration series, Incubation timeReporter gene assays, qRT-PCRFold repression, EC50 values

For statistical validity, implement randomization to avoid bias, include replications (minimum n=3) to increase precision, and use blocking when appropriate to reduce variability from uncontrolled factors . Factorial designs are particularly valuable as they allow assessment of both individual factors and their interactions.

After experimental execution, use statistical analysis software to generate response surface models that can predict optimal conditions for BioX activity and identify significant factor interactions.

How can researchers troubleshoot low activity of purified Recombinant Lysinibacillus sphaericus Protein BioX?

When facing challenges with low activity of purified BioX protein, a systematic troubleshooting approach is essential:

  • Protein Integrity Assessment:

    • Verify protein integrity through mass spectrometry (MS) analysis, similar to the approach used for confirming protein identity in R. anatipestifer studies .

    • Run size exclusion chromatography to confirm proper oligomeric state.

  • Buffer Optimization Strategy:

    • BioX likely requires specific buffer conditions for optimal activity, similar to the pH-dependent activity observed in Lysinibacillus strains (optimal pH range 6-8) .

    • Systematically test buffers with varying pH (6.0-9.0), salt concentrations (0-500 mM), and stabilizing agents (glycerol, reducing agents).

  • Activity Restoration Protocol:

    • If the protein was exposed to potentially denaturing conditions, attempt refolding through stepwise dialysis.

    • For DNA-binding proteins like BioX, activity often depends on proper metal cofactors; test supplementation with divalent cations (Mg²⁺, Mn²⁺, Zn²⁺).

  • Storage Stability Enhancement:

    • Aliquot protein into single-use volumes and store at -80°C.

    • Test protein stability with different cryoprotectants (10% glycerol, 1M trehalose).

What techniques are most effective for studying BioX binding to DNA sequences?

Several complementary techniques provide comprehensive characterization of BioX-DNA interactions:

TechniqueInformation ProvidedAdvantagesLimitations
Electrophoretic Mobility Shift Assay (EMSA)Qualitative binding, approximate affinitySimple, widely available equipmentLimited quantification, non-equilibrium conditions
Fluorescence AnisotropyBinding kinetics, Kd valuesReal-time measurements, solution-basedRequires fluorescent labeling
Surface Plasmon Resonance (SPR)Association/dissociation rates, affinity constantsLabel-free detection, real-time kineticsSurface immobilization may affect binding
ChIP-seqGenome-wide binding sites in vivoIdentifies actual binding locations in cellsComplex workflow, requires antibodies
DNase I FootprintingPrecise binding site identificationBase-pair resolution of protected regionsTechnically challenging, requires radiolabeling

For XRE-type regulators like BioX, a recommended workflow begins with in silico prediction of potential binding sites, followed by EMSA validation of binding, and then more detailed characterization using fluorescence anisotropy or SPR to determine binding constants. Finally, in vivo confirmation through ChIP-seq provides biological context for the binding interactions.

How might BioX contribute to the probiotic properties of Lysinibacillus strains?

Recent research on Lysinibacillus strains has demonstrated their potential as probiotics, particularly in aquaculture applications. Based on studies of Lysinibacillus sp. LYD11, several mechanisms have been identified that may involve BioX regulation :

  • Antimicrobial Activity Regulation: As a transcriptional regulator, BioX may control genes involved in producing antimicrobial compounds that inhibit pathogens like Vibrio harveyi and Vibrio alginolyticus, which LYD11 has shown strong activity against .

  • Adhesion and Colonization Properties: LYD11 demonstrates high hydrophobicity (82.73%) and self-aggregation (49.47%) rates, indicating strong adhesion capability . BioX may regulate genes responsible for cell surface properties that enable adhesion to intestinal surfaces.

  • Competitive Exclusion Mechanisms: LYD11 exhibits competition inhibition, rejection inhibition, and substitution inhibition against pathogenic bacteria . These mechanisms could be under BioX regulatory control, particularly if BioX responds to environmental signals in the intestinal tract.

  • Enzyme Production: LYD11 demonstrates protease and lipase activities . BioX might regulate the expression of these enzymes, which contribute to probiotic functionality.

The high adaptability of Lysinibacillus strains to various environmental conditions, including different NaCl concentrations, pH levels, and resistance to bile salts and digestive enzymes , suggests complex regulatory networks that likely involve transcriptional regulators like BioX.

What methods are recommended for studying structure-function relationships in BioX?

Understanding structure-function relationships in BioX requires an integrated approach combining computational and experimental methods:

ApproachMethodsApplications for BioX Research
Structural PredictionHomology modeling, AlphaFoldPredict DNA-binding domains, regulatory domains
Functional Domain MappingTruncation constructs, Site-directed mutagenesisIdentify critical residues for DNA binding and dimerization
Structural BiologyX-ray crystallography, NMR, Cryo-EMDetermine 3D structure, protein-DNA complexes
Binding Site IdentificationDNA footprinting, SELEXMap DNA recognition sequences
Conformational ChangesCircular dichroism, Fluorescence spectroscopyAssess structural changes upon ligand binding

For deeper structural insights, collaborative approaches with structural biology experts are recommended, as determining the crystal structure of BioX in both DNA-bound and unbound states would significantly advance understanding of its regulatory mechanism.

What optimization strategies are recommended for improving recombinant BioX expression?

Optimization of recombinant BioX expression requires systematic evaluation of multiple parameters, ideally using Design of Experiments (DoE) methodology to efficiently identify optimal conditions :

Expression Optimization Protocol:

  • Construct Optimization:

    • Test multiple fusion tags (His, GST, MBP) to improve solubility

    • Evaluate codon optimization for the host organism

    • Consider using synthetic genes with optimized GC content

  • Host Selection:

    • Compare expression levels in different E. coli strains (BL21, Rosetta, Arctic Express)

    • Test expression in native Bacillus/Lysinibacillus hosts if available

  • Culture Conditions DoE Matrix:

ParameterTest RangeMeasurement
Temperature16°C, 25°C, 30°C, 37°CSoluble protein yield
MediaLB, TB, 2xYT, Auto-inductionTotal expression level
Inducer concentration0.1-1.0 mM IPTGExpression vs. solubility
Post-induction time4h, 8h, 16h, 24hProtein quality and yield
  • Analytical Methods:

    • SDS-PAGE for total protein expression

    • Western blot for specific detection

    • Activity assays to confirm functional protein

Apply statistical analysis to identify significant factors and interactions, then verify the optimal conditions with validation runs. This systematic approach typically yields 2-5 fold improvements in functional protein yield compared to standard conditions .

How can researchers assess the specificity of BioX-DNA interactions?

Assessing the specificity of BioX-DNA interactions requires a multi-method approach:

  • Sequence Specificity Determination:

    • Perform competitive EMSA with specific vs. non-specific DNA

    • Use Systematic Evolution of Ligands by Exponential Enrichment (SELEX) to identify preferred binding sequences

    • Validate with mutational analysis of predicted binding sites

  • Specificity Quantification:

    • Calculate specificity ratio: K₁(non-specific DNA)/K₂(specific DNA)

    • Determine discrimination factor through competitive binding assays

    • Measure binding energetics through isothermal titration calorimetry

  • In Vivo Binding Profile Analysis:

    • ChIP-seq to map genome-wide binding sites

    • Motif analysis to identify consensus sequences

    • Correlation with transcriptional outcomes through RNA-seq

  • Cross-validation Strategy:

    • In vitro binding assays with purified components

    • Reporter gene assays with wild-type and mutated binding sites

    • In vivo validation in the native Lysinibacillus context

For XRE-type regulators like BioX, the DNA-binding specificity is typically determined by the helix-turn-helix motif in the N-terminal domain. Comparing the binding profile with other characterized XRE-family proteins can provide valuable insights into the evolutionary conservation of recognition sequences.

How can BioX research contribute to understanding probiotic mechanisms in aquaculture?

Research on BioX can significantly advance our understanding of probiotic mechanisms in aquaculture by elucidating regulatory networks governing beneficial properties of Lysinibacillus strains:

  • Pathogen Inhibition Mechanisms: Studies on Lysinibacillus sp. LYD11 have shown strong inhibitory activity against aquaculture pathogens like Vibrio harveyi and Vibrio alginolyticus . Understanding BioX's role in regulating genes involved in this antagonistic activity could help develop enhanced probiotic strains.

  • Colonization Efficiency: Lysinibacillus strains demonstrate strong colonization abilities in fish intestines, with detectable colonies persisting for at least 10 days after feeding . BioX may regulate genes involved in adhesion, as evidenced by the high hydrophobicity (82.73%) and self-aggregation (49.47%) properties of LYD11 .

  • Host-Microbe Interaction: BioX likely regulates genes that enable Lysinibacillus to survive in the gastrointestinal environment of fish, as demonstrated by LYD11's ability to grow under various NaCl concentrations (0.5-3.5%) and pH levels (6-8) .

  • Safety and Antibiotic Resistance: Studies have shown that Lysinibacillus strains like LYD11 are safe for fish application, with no hemolytic activity and sensitivity to multiple antibiotics . Understanding BioX's potential role in regulating these properties could inform safety assessments of probiotic candidates.

By characterizing BioX-regulated genes, researchers can better understand how Lysinibacillus probiotics exert their beneficial effects, potentially leading to improved strain selection and enhancement strategies for sustainable aquaculture.

What research design would best address contradictory findings in BioX activity studies?

When facing contradictory findings in BioX activity studies, a systematic research design using DoE principles can help resolve inconsistencies:

Research Design Strategy:

  • Meta-analysis of Contradictory Findings:

    • Systematically compare experimental conditions across studies

    • Identify potential confounding variables

    • Formulate testable hypotheses to explain discrepancies

  • Comprehensive Factorial Experiment:

    • Design a full or fractional factorial experiment incorporating all suspected variables

    • Include the following factors:

      • BioX source/constructs

      • Expression/purification methods

      • Assay conditions (pH, temperature, salt)

      • DNA substrate variations

      • Presence of potential cofactors

  • Standardized Protocol Development:

    • Establish a robust, reproducible protocol with defined:

      • Quality control criteria for protein preparations

      • Validated positive and negative controls

      • Statistical analysis methods

  • Collaborative Validation:

    • Implement round-robin testing across multiple laboratories

    • Use identical reagents and protocols

    • Apply rigorous statistical analysis

This approach aligns with the principles of randomization, replication, blocking, and factorial experimentation that form the foundation of DoE . By systematically evaluating all potential sources of variation, researchers can identify which factors significantly influence BioX activity and under what conditions contradictory results might arise.

How can researchers apply knowledge of BioX to develop biotechnological applications?

Understanding the molecular properties and regulatory functions of BioX opens several avenues for biotechnological applications:

  • Engineered Biosensors: As a transcriptional regulator, BioX could be engineered to respond to specific environmental signals or compounds of interest. By fusing BioX-responsive promoters with reporter genes, researchers could develop biosensors for environmental monitoring or diagnostic applications.

  • Probiotics Enhancement: The role of Lysinibacillus strains as probiotics in aquaculture could be enhanced by modulating BioX expression. Upregulating beneficial properties (such as antimicrobial compound production) while downregulating potentially harmful ones could create improved probiotic strains with enhanced specificity against pathogens like Vibrio species.

  • Synthetic Biology Tools: Modified BioX variants could serve as regulatory elements in synthetic genetic circuits, particularly for applications requiring environment-responsive gene expression. The natural ability of XRE-type regulators to respond to specific signals makes them valuable components for programmable biological systems.

  • Targeted Protein Expression Systems: Understanding BioX regulation could lead to the development of finely tuned expression systems for heterologous proteins in Lysinibacillus or related hosts, potentially offering advantages for proteins that are difficult to express in conventional systems.

  • Biocontrol Applications: Since some Lysinibacillus species have insecticidal properties, manipulating BioX-regulated pathways could potentially enhance their effectiveness as biocontrol agents, providing environmentally friendly alternatives to chemical pesticides.

Each of these applications would benefit from the methodological approaches outlined in the Design of Experiments framework , ensuring systematic optimization and validation of the developed technologies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.