Recombinant Macaca arctoides C-C chemokine receptor type 5 (CCR5)

Shipped with Ice Packs
In Stock

Description

Role in HIV/SIV Pathogenesis

  • Coreceptor Function: CCR5 facilitates HIV-1 entry by binding viral gp120, a mechanism conserved in macaques . CXCR4- and CCR5-tropic HIV-1 clones replicate in rhesus macaque cells, demonstrating functional overlap with human CCR5 .

  • Species-Specific Variations: Substitutions at positions 13 (N→D) and 129 (V→I) in Macaca arctoides CCR5 alter CD4-independent SIV binding, impacting viral tropism .

Applications in Biomedical Research

  • HIV Entry Studies: Used to map viral entry mechanisms and evaluate inhibitors in nonhuman primate models .

  • Immune Cell Migration: Assays for chemokine-driven T-cell and macrophage trafficking .

  • Drug Development: Preclinical testing of CCR5 antagonists for HIV prevention .

Comparative Analysis with Primate CCR5 Homologues

A phylogenetic study of 24 primate species revealed:

  • Cercopithecidae Family: Macaca arctoides CCR5 shares 96–99% amino acid identity with human CCR5, higher than prosimians (87%) or New World monkeys (91–92%) .

  • Functional Divergence: Amino acid changes in extracellular domains influence viral coreceptor usage and ligand binding .

Limitations and Future Directions

  • Replicative Variability: HIV-1 clones exhibit divergent growth kinetics in macaque cells due to TRIM5α alleles and CCR5 polymorphisms .

  • Therapeutic Challenges: Variable inhibitor responses highlight the need for personalized approaches in targeting CCR5 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are flexible to accommodate your specific requirements. Please indicate any format preferences when placing your order and we will do our best to fulfill your request.
Lead Time
Delivery time may vary based on your purchase method and location. We recommend contacting your local distributor for precise delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple use, aliquoting is essential. Avoid repeated freeze-thaw cycles to maintain protein integrity.
Tag Info
Tag type is determined during the manufacturing process.
Please specify any tag type requirements during your order placement, and we will prioritize development of the specified tag.
Synonyms
CCR5; CMKBR5; C-C chemokine receptor type 5; C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CD antigen CD195
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-352
Protein Length
full length protein
Species
Macaca arctoides (Stump-tailed macaque)
Target Names
Target Protein Sequence
MDYQVSSPTYDIDYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNILVVLILINCKR LKSMTDIYLLNLAISDLLFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFII LLTIDRYLAIVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQREGLHYTCSS HFPYSQYQFWKNFQTLKMVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTI MIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFV GEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTAEQEISVGL
Uniprot No.

Target Background

Function
This protein acts as a receptor for several inflammatory CC-chemokines, including CCL3/MIP-1-alpha, CCL4/MIP-1-beta, and RANTES. Upon binding, it transduces a signal by increasing intracellular calcium ion levels. It may play a role in controlling granulocytic lineage proliferation or differentiation. Furthermore, it participates in T-lymphocyte migration to infection sites by serving as a chemotactic receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Macaca arctoides CCR5 and how does it compare structurally to human CCR5?

Macaca arctoides (stump-tailed macaque) CCR5 is a G protein-coupled receptor that functions as a chemokine receptor. The full-length protein consists of 352 amino acids and shares high sequence homology with human CCR5, though with species-specific variations . The recombinant form typically includes an N-terminal His-tag when expressed in prokaryotic systems such as E. coli .

What are the primary applications of recombinant Macaca arctoides CCR5 in research?

Recombinant Macaca arctoides CCR5 serves multiple research purposes:

  • Comparative receptor studies: Investigating structural and functional differences between human and non-human primate CCR5 to understand species-specific responses to viral infection

  • Binding assays: Evaluating interactions with natural ligands (MCP-2, MIP-1α, MIP-1β, RANTES) and potential therapeutic molecules

  • SIV/HIV research: Examining coreceptor functionality in viral entry mechanisms across primate species

  • Evolutionary immunology: Studying genetic variations that influence disease susceptibility or resistance

  • Antibody development and validation: Generating and testing antibodies targeting specific CCR5 epitopes

  • Protein-protein interaction studies: Investigating associations with other cellular components

These applications typically employ the protein in various experimental formats including SDS-PAGE, Western blotting, and binding assays .

How should recombinant Macaca arctoides CCR5 be reconstituted and stored for optimal stability?

For optimal stability and functionality, recombinant Macaca arctoides CCR5 protein requires specific handling procedures:

  • Reconstitution: The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial.

  • Storage preparation: Add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) . This prevents damage from freeze-thaw cycles.

  • Aliquoting: Divide the reconstituted protein into small working aliquots to minimize repeated freeze-thaw cycles.

  • Temperature conditions:

    • Short-term storage (up to one week): 4°C

    • Long-term storage: -20°C to -80°C

  • Avoid repeated freeze-thaw cycles: These significantly reduce protein stability and functionality.

Storage in Tris/PBS-based buffer with 6% trehalose at pH 8.0 has been shown to maintain protein integrity . For applications requiring functional activity, validation of protein activity after storage and reconstitution is recommended.

How do natural mutations in macaque CCR5 affect SIV infection patterns compared to mutations in human CCR5?

Studies across primate species reveal fascinating evolutionary convergence regarding CCR5 mutations:

In sooty mangabeys (Cercocebus atys), a natural host for SIV, two CCR5 mutations have been identified: a two base pair deletion (Δ2) and a 24 base pair deletion (Δ24), with frequencies of 26% and 3% respectively in captive populations . These mutations result in truncated CCR5 proteins that are not expressed on the cell surface. Remarkably, sooty mangabeys homozygous for these null alleles (approximately 8% of the population) remain susceptible to SIVsmm infection and maintain robust viral loads .

This contrasts with human CCR5Δ32 homozygotes, who demonstrate strong resistance to HIV-1 infection. The difference lies in alternative coreceptor usage: SIVsmm efficiently utilizes alternative coreceptors including CXCR6, GPR15, and GPR1 in addition to CCR5 .

For Macaca arctoides, comprehensive studies of natural CCR5 mutations and their impact on SIV infection patterns are still emerging. Comparative analysis with other macaque species and natural SIV hosts provides valuable insights into coreceptor evolution and viral adaptation strategies across primates.

What methodological challenges exist in studying conformational epitopes of Macaca arctoides CCR5 compared to human CCR5?

Investigating conformational epitopes of Macaca arctoides CCR5 presents several methodological challenges:

  • Expression system limitations: The E. coli expression system commonly used for recombinant production lacks post-translational modifications essential for proper folding of membrane proteins. This potentially alters conformational epitopes compared to the native structure.

  • Membrane protein solubilization: As a seven-transmembrane receptor, CCR5 requires careful detergent selection to maintain native conformation while removing it from the membrane environment.

  • Species-specific antibody cross-reactivity: Antibodies developed against human CCR5 may show variable cross-reactivity with Macaca arctoides CCR5 due to sequence divergence at key epitopes.

  • Structural stability: Conformational epitopes are sensitive to buffer conditions, temperature, and pH, potentially leading to inconsistent results across experimental setups.

  • Validation methods: Confirming the native-like conformation of recombinant CCR5 requires specialized techniques like circular dichroism or ligand binding assays.

Researchers can address these challenges through complementary approaches including: (1) expression in mammalian or insect cell systems that better preserve native conformations; (2) nanobody development specific to conformational epitopes; and (3) comparative binding studies with chemokine ligands that recognize specific conformational states.

How does alternative coreceptor usage in SIV infection of natural hosts inform research approaches with recombinant Macaca arctoides CCR5?

The discovery of alternative coreceptor usage in natural SIV hosts has profound implications for research with recombinant Macaca arctoides CCR5:

Studies in sooty mangabeys revealed that SIVsmm can efficiently infect animals lacking functional CCR5 by utilizing alternative coreceptors including CXCR6, GPR15, and GPR1 . This phenomenon explains why SIVsmm infection remains robust in CCR5-null animals and suggests a more complex viral entry mechanism than previously understood.

For Macaca arctoides CCR5 research, these findings necessitate:

  • Expanded coreceptor panels: Research should include alternative coreceptors when studying viral entry mechanisms, rather than focusing exclusively on CCR5.

  • Cell type heterogeneity consideration: The distribution of alternative coreceptors across different immune cell populations may explain cell targeting patterns observed in vivo.

  • Evolutionary context analysis: Comparative studies of coreceptor usage across primate species can reveal evolutionary adaptations in both host and virus.

  • Functional redundancy exploration: The presence of alternative entry pathways suggests functional redundancy that may influence therapeutic approaches targeting entry inhibition.

  • Non-pathogenic infection mechanisms: Understanding why alternative coreceptor usage in natural hosts correlates with non-pathogenic infection could inform novel therapeutic strategies.

This broader perspective on viral entry mechanisms challenges the predominant CCR5-centric model and suggests that comprehensive analysis of multiple coreceptors will provide more accurate insights into host-pathogen interactions .

What approaches can optimize the expression and purification of functional recombinant Macaca arctoides CCR5?

Optimizing expression and purification of functional Macaca arctoides CCR5 requires addressing several challenges inherent to membrane proteins:

Expression system selection:

  • E. coli: While commonly used for its simplicity and cost-effectiveness , it lacks post-translational modifications and may not produce properly folded CCR5

  • Insect cells: Baculovirus expression systems provide better post-translational modifications

  • Mammalian cells: HEK293 or CHO cells offer native-like modifications but at higher cost

Optimization strategies:

  • Fusion tags: The N-terminal His-tag facilitates purification via immobilized metal affinity chromatography (IMAC) , but additional solubility-enhancing tags (MBP, SUMO) may improve yield

  • Codon optimization: Adapting codons to the expression host can enhance translation efficiency

  • Induction conditions: Lower temperatures (16-20°C) and reduced inducer concentrations often increase the proportion of properly folded membrane proteins

  • Detergent screening: Systematic testing of detergents (DDM, LMNG, GDN) for efficient extraction while maintaining native conformation

  • Lipid supplementation: Addition of specific lipids during purification can stabilize the protein

Purification approach:

  • Initial capture using IMAC with His-tag affinity

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Validation of functionality through ligand binding assays with natural chemokines

  • Quality control via SDS-PAGE, Western blotting, and circular dichroism to assess purity and folding

For functional studies, reconstitution into lipid nanodiscs or proteoliposomes may better preserve native activity compared to detergent-solubilized preparations.

What considerations are important when designing experiments to compare CCR5 functionality across primate species?

Designing robust comparative experiments for CCR5 functionality across primate species requires careful attention to several factors:

Sequence and structural considerations:

  • Allelic variation: Natural populations of primates exhibit polymorphisms in CCR5 that affect function, such as the Δ2 and Δ24 alleles in sooty mangabeys

  • Post-translational modifications: Differences in glycosylation and phosphorylation patterns between species may affect receptor function

  • Expression levels: Natural variation in CCR5 expression levels exists between species (notably low in sooty mangabeys)

Experimental design parameters:

  • Equivalent expression systems: Use identical expression vectors and host cells when comparing CCR5 variants to minimize system-based artifacts

  • Matched protein quantification: Ensure equivalent receptor density in functional assays

  • Multiple functional readouts: Include diverse assays measuring:

    • Ligand binding affinities

    • Calcium flux responses

    • Chemotaxis

    • Viral entry efficiency

    • Signaling pathway activation

  • Physiologically relevant conditions: pH, ion concentrations, and temperature should reflect in vivo environments

Control considerations:

  • Positive controls: Include well-characterized human CCR5 in parallel experiments

  • Cross-species ligands: Test identical chemokine preparations across all species variants

  • Cell background controls: Express receptors in CCR5-negative cell lines to eliminate endogenous receptor effects

Advanced analytical approaches:

  • Dose-response curves rather than single-point measurements

  • Time-course analyses to capture kinetic differences in response

  • Cross-competition assays between different ligands

  • Chimeric receptors to map species-specific functional domains

These considerations ensure that observed functional differences reflect true biological variation rather than methodological artifacts.

How can recombinant Macaca arctoides CCR5 be utilized in comparative studies of HIV/SIV entry mechanisms?

Recombinant Macaca arctoides CCR5 provides a valuable tool for dissecting species-specific aspects of lentiviral entry:

Comparative binding and entry studies:

  • Receptor affinity analysis: Direct comparison of binding affinities between HIV/SIV envelope proteins and CCR5 from different primate species using surface plasmon resonance or flow cytometry

  • Entry efficiency assessment: Pseudotyped virus assays using reporter systems to quantify entry mediated by different CCR5 orthologs

  • Mutagenesis mapping: Systematic mutation of specific CCR5 residues to identify determinants of species-specific entry restrictions

Evolutionary insights:

  • Selection pressure analysis: Comparing naturally occurring polymorphisms across primate CCR5 orthologs to identify regions under positive selection

  • Adaptation mapping: Identification of viral adaptations that overcome species barriers through serial passage experiments

  • Host range determination: Testing diverse SIV strains against panels of primate CCR5 variants to define host range constraints

Alternative coreceptor investigation:

  • Competitive inhibition assays: Determining whether alternative coreceptors (CXCR6, GPR15, GPR1) used by SIVsmm show similar patterns with Macaca arctoides CCR5

  • Cell-type specific effects: Comparing entry efficiency in different cell types expressing variable levels of CCR5 and alternative coreceptors

  • In vitro evolution experiments: Selecting for viral variants that can utilize Macaca arctoides CCR5 when human CCR5 is blocked

These approaches can reveal molecular determinants of host range, pathogenicity, and species barriers in lentiviral infections, contributing to our understanding of viral zoonoses and potential therapeutic targets.

What does research on CCR5 mutations across primate species reveal about evolutionary pressure and disease resistance?

Studies of CCR5 across primate species reveal fascinating patterns of convergent evolution and provide insights into host-pathogen dynamics:

Convergent evolution of null mutations:

  • Human CCR5Δ32: 32bp deletion resulting in truncated, non-functional receptor; confers resistance to HIV-1 infection

  • Sooty mangabey Δ2 and Δ24 alleles: Two independent mutations (26% and 3% frequencies respectively) resulting in non-functional CCR5; animals remain susceptible to SIVsmm through alternative coreceptors

  • Red-capped mangabey CCR5Δ24: Similar to sooty mangabey mutation but independently evolved

This convergent evolution suggests strong selective pressure on CCR5, likely driven by pathogen exposure throughout primate evolution.

Differential impact on viral susceptibility:

  • Humans: CCR5-null individuals show strong resistance to CCR5-tropic HIV-1

  • Natural SIV hosts: CCR5-null sooty mangabeys remain susceptible to SIVsmm through alternative entry pathways

  • Asian macaques: Limited data on null mutations, but differences in CCR5 expression levels influence SIV pathogenesis

Evolutionary trade-offs:

  • Balanced selection: The persistence of CCR5 mutations at moderate frequencies suggests balancing selection, where heterozygotes may have advantages

  • Immunological consequences: CCR5 plays roles in responses to bacterial and parasitic infections, suggesting potential fitness costs to CCR5 loss

  • Alternative pathway compensation: Natural SIV hosts may have evolved compensatory mechanisms allowing alternative coreceptor use without pathological consequences

Implications for disease models:

  • Species-specific coreceptor usage: Data indicates that reliance on CCR5 versus alternative coreceptors varies across primate species

  • Pathogenesis mechanisms: Alternative coreceptor usage in natural hosts correlates with non-pathogenic infection despite high viral loads

  • Cell targeting effects: The distribution of CCR5 versus alternative coreceptors likely influences which cell populations become infected, potentially explaining differences in pathogenesis

These evolutionary patterns provide critical context for interpreting experimental results and developing more accurate animal models of human disease.

What strategies can optimize CRISPR-Cas9 editing of CCR5 in macaque models based on current research?

CRISPR-Cas9 editing of CCR5 in macaque models presents both opportunities and challenges, as revealed by recent research:

Current challenges identified:

  • Large-scale deletions: CRISPR-Cas9 editing of CCR5 in Mauritian cynomolgus macaque (MCM) embryos has resulted in unintended large-scale deletions

  • Mosaicism: Greater cellular mosaicism has been observed within individual embryos than previously identified using PCR-based methods

  • Viability concerns: Large-scale on- and off-target mutations may hinder establishment of viable pregnancies

Optimization strategies:

  • Guide RNA design improvements:

    • Use multiple prediction algorithms to identify guides with minimal off-target potential

    • Target conserved regions based on cross-species alignment of macaque CCR5 sequences

    • Design guides to create specific deletions that mimic naturally occurring null alleles (like those in sooty mangabeys)

  • Delivery method refinement:

    • Ribonucleoprotein (RNP) complex delivery rather than plasmid-based expression to reduce off-target effects

    • Titration of CRISPR components to minimize toxicity while maintaining editing efficiency

    • Timing optimization for one-cell versus two-cell stage embryo injection

  • Advanced screening techniques:

    • Whole genome sequencing to comprehensively evaluate on- and off-target editing

    • Single-cell sequencing to assess mosaicism more accurately

    • Functional validation using HIV/SIV challenge assays in derived cell lines

  • Alternative approaches:

    • Base editing or prime editing technologies that introduce precise modifications with reduced DNA cutting

    • Targeting of intronic regions that affect splicing rather than coding sequences

    • Knockdown approaches using shRNA as alternatives to permanent genetic modification

Implementation of these strategies could facilitate the generation of viable CCR5-modified macaque models while minimizing unintended genetic alterations that complicate interpretation of experimental results .

How can alternative coreceptor usage be quantitatively assessed in experiments involving recombinant Macaca arctoides CCR5?

Quantitative assessment of alternative coreceptor usage alongside Macaca arctoides CCR5 requires sophisticated experimental approaches:

Cell-based functional assays:

  • Receptor competition assays:

    • Express Macaca arctoides CCR5 alongside alternative coreceptors (CXCR6, GPR15, GPR1) in indicator cell lines

    • Measure entry efficiency of pseudotyped viruses in the presence of selective antagonists

    • Calculate relative contribution of each pathway through selective blocking experiments

  • CRISPR knockout panels:

    • Generate cell lines with various combinations of coreceptor knockouts

    • Quantify entry efficiency differences to determine relative usage

    • Complement with receptor re-expression to confirm specificity

Binding and affinity measurements:

  • Surface plasmon resonance (SPR):

    • Immobilize purified recombinant coreceptors

    • Measure binding kinetics (kon, koff) and affinity (KD) of viral envelope proteins

    • Compare binding parameters across different coreceptors

  • Flow cytometry-based approaches:

    • Labeled envelope trimers or domain-specific antibodies

    • Quantify binding to cells expressing individual coreceptors

    • Analyze competition between soluble chemokines and viral envelope binding

Ex vivo analysis of primary cells:

Data analysis approaches:

  • Statistical modeling to determine the relative contribution of each coreceptor

  • Hierarchical clustering to identify patterns of coreceptor usage across viral isolates

  • Bayesian network analysis to infer relationships between coreceptor expression and entry efficiency

These methodologies enable precise quantification of the relative importance of Macaca arctoides CCR5 versus alternative entry pathways in different experimental contexts .

What data analysis approaches are most effective for comparative studies of CCR5 functionality across primate species?

Effective analysis of comparative CCR5 functionality across primate species requires sophisticated computational approaches:

Sequence-based analyses:

  • Phylogenetic analysis:

    • Maximum likelihood or Bayesian inference methods to establish evolutionary relationships

    • Ancestral sequence reconstruction to identify key evolutionary changes

    • Selection analysis (dN/dS ratios) to identify positively selected sites

  • Structure-function prediction:

    • Homology modeling based on crystal structures of human CCR5

    • Molecular dynamics simulations to predict species-specific conformational differences

    • Binding pocket analysis to identify species-specific ligand interactions

Functional data analysis:

  • Multiparametric comparison:

    • Principal component analysis (PCA) to identify patterns in multidimensional functional data

    • Hierarchical clustering to group species by functional similarity

    • Machine learning approaches to identify determinants of functional differences

  • Dose-response modeling:

    • Non-linear regression to derive EC50/IC50 values for ligand interactions

    • Statistical comparison of curve parameters across species

    • Operational models to distinguish affinity from efficacy differences

Integration of multiple data types:

  • Structure-activity relationship (SAR) analysis:

    • Correlation of sequence variations with functional parameters

    • Identification of critical residues determining species-specific responses

    • Development of predictive models for untested species variants

  • Network analysis:

    • Signaling pathway activation patterns across species

    • Protein-protein interaction networks

    • Systems biology approaches to understand cellular context effects

Visualization approaches:

  • Interactive heatmaps combining sequence and functional data

  • Structural visualization of species-specific differences

  • Network diagrams showing evolutionary relationships and functional clustering

These analytical frameworks help researchers move beyond simple descriptive comparisons to mechanistic understanding of how sequence variations translate to functional differences in CCR5 across primate species, with implications for viral susceptibility and immune function.

How should researchers integrate data on CCR5 and alternative coreceptor usage when evaluating SIV infection models?

Integrating CCR5 and alternative coreceptor usage data requires a comprehensive framework that accounts for the complexity of viral entry mechanisms:

Data integration strategies:

  • Correlation matrices:

    • Map relationships between coreceptor expression levels and viral entry efficiency

    • Identify patterns across cell types and viral isolates

    • Develop predictive models of tropism based on coreceptor expression profiles

  • Multivariate analysis:

    • Principal component analysis to identify major sources of variation in coreceptor usage

    • Cluster analysis to group viral isolates by entry pathway preferences

    • Multidimensional scaling to visualize relationships between different primate models

  • Bayesian network modeling:

    • Incorporate prior knowledge about entry pathways

    • Estimate conditional probabilities of infection based on coreceptor availability

    • Update models as new experimental data becomes available

Contextual factors to consider:

  • Cell type specificity:

    • Differential expression of CCR5 and alternative coreceptors across immune cell subsets

    • Cell-specific post-translational modifications affecting receptor function

    • Coreceptor density effects on entry efficiency

  • Viral adaptation dynamics:

    • Changes in coreceptor preference during infection

    • Evolutionary trajectories in different host environments

    • Founder effects in cross-species transmission events

  • Host genetic background:

    • CCR5 genotype (wild-type vs. mutant alleles) effects on pathogenesis

    • Regulatory polymorphisms affecting coreceptor expression levels

    • Species-specific differences in post-entry restriction factors

Integrated analysis framework:

  • Start with comprehensive profiling of coreceptor expression across relevant cell populations

  • Characterize entry efficiency through multiple coreceptor pathways for diverse viral isolates

  • Correlate coreceptor usage patterns with pathogenesis outcomes

  • Develop mathematical models that predict viral tropism based on coreceptor availability

  • Validate predictions with experimental challenges in relevant animal models

This integrated approach acknowledges that SIV infection in natural hosts involves both CCR5-dependent and CCR5-independent pathways , providing a more accurate framework for evaluating infection models and interpreting experimental results.

What research gaps remain in understanding the role of Macaca arctoides CCR5 in SIV/HIV pathogenesis?

Despite significant advances, several critical knowledge gaps remain regarding Macaca arctoides CCR5 and its role in lentiviral pathogenesis:

Molecular characterization gaps:

  • Natural polymorphisms: Unlike in sooty mangabeys , the prevalence and functional consequences of CCR5 polymorphisms in natural Macaca arctoides populations remain poorly characterized

  • Expression patterns: Detailed quantification of CCR5 expression across immune cell subsets in Macaca arctoides compared to other macaque species and natural SIV hosts

  • Structural determinants: Crystal structures of macaque CCR5 variants to identify species-specific conformational differences affecting viral interactions

Functional understanding gaps:

  • Alternative coreceptor hierarchy: The relative efficiency of CCR5 versus alternative coreceptors (CXCR6, GPR15, GPR1) in mediating SIV entry in Macaca arctoides cells remains undefined

  • Signaling consequences: How species-specific differences in CCR5 structure affect downstream signaling pathways and immune cell function

  • Post-translational regulation: Species-specific differences in CCR5 glycosylation, phosphorylation, and desensitization mechanisms

Pathogenesis mechanism gaps:

  • Relationship to disease progression: Correlation between CCR5 expression patterns/polymorphisms and SIV pathogenesis in Macaca arctoides

  • Cell targeting consequences: How differences in coreceptor usage affect the specific cell populations infected and subsequent immune dysfunction

  • Evolutionary adaptations: Mechanisms by which Macaca arctoides may have evolved to modulate CCR5 function in response to pathogen pressure

Methodological challenges:

  • Standardized assays: Development of consistent methodologies for comparing CCR5 function across species

  • In vivo models: Limited availability of Macaca arctoides for experimental SIV infection studies

  • Single-cell analysis: Need for high-resolution techniques to analyze coreceptor expression and viral infection at the single-cell level

Addressing these gaps would significantly advance our understanding of species-specific differences in lentiviral pathogenesis and potentially identify novel therapeutic approaches based on natural resistance mechanisms.

What emerging technologies could enhance our understanding of CCR5 function across primate species?

Several cutting-edge technologies show promise for revolutionizing comparative CCR5 research:

Advanced structural biology approaches:

  • Cryo-electron microscopy (Cryo-EM):

    • Near-atomic resolution structures of CCR5 from different primate species

    • Visualization of conformational differences in ligand-bound states

    • Complex structures with viral envelope proteins to identify species barriers

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Mapping conformational dynamics of CCR5 variants

    • Identifying regions with species-specific flexibility differences

    • Characterizing allosteric networks within the receptor

Single-cell technologies:

  • Single-cell RNA sequencing:

    • Comprehensive profiling of CCR5 and alternative coreceptor expression across immune cell subsets

    • Identification of rare cell populations with unique coreceptor expression patterns

    • Trajectory analysis of expression changes during infection

  • Mass cytometry (CyTOF):

    • Simultaneous measurement of coreceptor proteins and phospho-signaling events

    • Correlation with cellular activation states

    • High-dimensional analysis of infection patterns in heterogeneous cell populations

Genome engineering technologies:

  • Prime editing and base editing:

    • Precise introduction of specific CCR5 variants without double-strand breaks

    • Generation of isogenic cell lines differing only in CCR5 sequence

    • Recreation of naturally occurring polymorphisms with minimal off-target effects

  • Humanized and chimeric animal models:

    • Transgenic expression of different primate CCR5 variants in mouse models

    • Domain-swapped CCR5 chimeras to map species-specific functional regions

    • CRISPR-engineered macaques expressing CCR5 variants from other species

Systems biology approaches:

  • Spatial transcriptomics:

    • Mapping coreceptor expression within tissue microenvironments

    • Visualization of infection patterns in relation to coreceptor distribution

    • Integration with histopathology to correlate with disease progression

  • Multi-omics integration:

    • Combining genomics, transcriptomics, proteomics, and metabolomics data

    • Network analysis to identify species-specific differences in CCR5 regulation

    • Predictive modeling of infection outcomes based on integrated datasets

These technologies, particularly when used in combination, offer unprecedented opportunities to understand the molecular details of how CCR5 variation across primate species influences viral susceptibility, immune function, and disease pathogenesis.

What are the most important considerations for researchers designing experiments with recombinant Macaca arctoides CCR5?

When designing experiments with recombinant Macaca arctoides CCR5, researchers should prioritize several critical considerations to ensure meaningful and reproducible results:

Experimental design considerations:

  • Appropriate controls:

    • Include human CCR5 and CCR5 from other relevant primate species for comparative analysis

    • Use multiple cell backgrounds to account for cell-specific effects

    • Include both positive and negative controls for all functional assays

  • Expression system selection:

    • Match expression systems (E. coli, insect cells, mammalian cells) to experimental questions

    • Consider that E. coli-expressed protein lacks post-translational modifications

    • For functional studies, mammalian expression may better represent native CCR5

  • Alternative coreceptor context:

    • Design experiments accounting for the potential role of alternative coreceptors (CXCR6, GPR15, GPR1)

    • Consider combinatorial expression patterns rather than studying CCR5 in isolation

    • Include assays measuring alternative pathway contributions

Technical considerations:

  • Protein quality control:

    • Rigorous validation of protein folding and functionality

    • Careful attention to storage and handling conditions to maintain activity

    • Batch-to-batch consistency testing

  • Methodological standardization:

    • Consistent protocols across comparative studies

    • Quantitative rather than qualitative assessments where possible

    • Multiple methodological approaches to verify key findings

  • Biological relevance:

    • Consider physiological expression levels rather than overexpression systems

    • Include primary cell validation when possible

    • Correlate in vitro findings with available in vivo data

Interpretive framework:

  • Evolutionary context:

    • Interpret findings within the broader context of primate CCR5 evolution

    • Consider selective pressures that have shaped species differences

    • Acknowledge the complex interplay between host genetics and viral adaptation

  • Translational perspective:

    • Clearly define how findings in Macaca arctoides CCR5 relate to human disease

    • Specify limitations in cross-species extrapolation

    • Identify potential therapeutic implications while acknowledging species differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.