Recombinant Macaca fascicularis 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant AGPAT4 from Macaca fascicularis is expressed as a full-length protein (1-378 amino acids) with an N-terminal His tag for purification. Key specifications include:

PropertyDetails
UniProt IDQ4R581
Expression SystemEscherichia coli
Molecular Weight~44 kDa (theoretical)
Purity>90% (SDS-PAGE)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0); avoid freeze-thaw cycles

The amino acid sequence begins with MDLAGLLKSQFLCHLVFCYVFIASGLIINTVQL... and includes conserved motifs critical for acyltransferase activity, such as KX₂LX₆GX₁₂R .

Enzymatic Function and Substrate Specificity

AGPAT4 belongs to the 1-acylglycerol-3-phosphate O-acyltransferase family and exhibits the following biochemical properties:

  • Catalytic Role: Converts LPA to PA by transferring an acyl group to the sn-2 position of glycerol-3-phosphate, forming phosphatidic acid .

  • Substrate Preference: Demonstrates specificity for LPA over other lysophospholipids, distinguishing it from other AGPAT isoforms .

  • Tissue-Specific Activity: In Macaca fascicularis, AGPAT4-derived PA preferentially supports phosphatidylinositol (PI), phosphatidylcholine (PC), and phosphatidylethanolamine (PE) synthesis in neural tissues .

Research Findings from Knockout Models

Studies in mice provide insights into AGPAT4's metabolic roles:

3.1. Lipid Homeostasis

  • Adipose Tissue: AGPAT4-deficient mice (Agpat4⁻/⁻) exhibit increased TAG content and adipocyte hypertrophy in epididymal white adipose tissue (WAT), linked to upregulated Lpin1 and Dgat1 gene expression .

  • Brain Lipidomics: AGPAT4 supports PI, PC, and PE synthesis in murine brains, suggesting tissue-specific substrate channeling .

3.2. Age-Dependent Metabolic Phenotypes

  • Body Weight: Middle-aged Agpat4⁻/⁻ mice (14 months) show 20% lower body weight vs. wild-type, despite similar food intake .

  • Energy Expenditure: Elevated VO₂ (~20%), VCO₂ (~30%), and respiratory exchange ratio (RER) indicate increased oxidative metabolism and mitochondrial uncoupling .

Applications in Lipid Research

Recombinant AGPAT4 is utilized for:

  • In Vitro Assays: Studying acyltransferase kinetics and substrate specificity .

  • Pathway Analysis: Investigating glycerolipid and glycerophospholipid metabolism (e.g., CDP-diacylglycerol biosynthesis) .

  • Drug Development: Screening inhibitors targeting lipid disorders like lipodystrophy or obesity .

Comparative Isoform Analysis

AGPAT4 differs from other AGPAT isoforms in localization and function:

IsoformLocalizationKey RolePhenotype of Deficiency
AGPAT1MicrosomesUbiquitous TAG synthesisNeonatal lethality, seizures
AGPAT2MicrosomesAdipose TAG synthesisLipodystrophy, insulin resistance
AGPAT4Mitochondria/ER/GolgiNeural phospholipid synthesisAge-dependent metabolic dysregulation

Technical Considerations for Use

  • Reconstitution: Lyophilized protein requires dissolution in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for stability .

  • Activity Assays: Optimal activity is measured using radiolabeled acyl-CoA donors and LPA substrates in buffer systems mimicking physiological pH .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by factors such as storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
AGPAT4; QccE-15256; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTVQLFTLLLWPINKQLFRKINCRLSYCISSQ LVMLLEWWSGTECTIFTDPRAYPKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKV LAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRF TEKKHEISMQVARAKGLPRLKHHPLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTL LGVLNGKKYHADLYVRRIPLEDIPEDDDRCSAWLHKLYQEKDAFQEEYYRTGTFPETPMV PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASMGVRWMIGVTE IDKGSAYGNSDSKQKQND
Uniprot No.

Target Background

Function
Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, particularly docosahexaenoyl-CoA (22:6-CoA, DHA-CoA).
Database Links

KEGG: mcf:101925210

UniGene: Mfa.1676

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is AGPAT4 and what biological function does it serve?

AGPAT4 (1-acyl-sn-glycerol-3-phosphate acyltransferase delta) is an enzyme that catalyzes the second step in the de novo synthesis of glycerophospholipids and triacylglycerols. Specifically, it converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone . This enzymatic reaction is critical for membrane biogenesis and lipid metabolism in various tissues. The protein is encoded by the AGPAT4 gene in humans, with homologs present in various mammalian species including Macaca fascicularis (crab-eating macaque) . In previous studies, AGPAT4 has been identified as a mitochondrial lysophosphatidic acid acyltransferase that is most highly expressed in brain tissues .

How does AGPAT4 expression vary during embryonic development?

Research has demonstrated that AGPAT4 exhibits dynamic expression patterns during embryonic development. In murine models, Agpat4 mRNA levels show significant temporal regulation across developmental timepoints. Specifically, quantitative analysis revealed that Agpat4 is upregulated 3.7-fold at embryonic day E14.5 compared to day E10.5 . Interestingly, as development progresses toward birth, Agpat4 mRNA levels decrease dramatically to only 4% of E14.5 levels by day E18.5 . This distinctive expression pattern suggests AGPAT4 may play specialized roles during specific windows of embryonic development, particularly during mid-gestation when organogenesis, including neurogenesis, is highly active.

In which cell types is AGPAT4 typically expressed?

Immunohistochemical analyses of primary cortical cultures derived from E18.5 mouse brains have demonstrated that AGPAT4 protein is detectable in both neurons and glial cells . When using neuron-specific markers such as NESTIN and fluorescent Nissl stains, AGPAT4 shows co-localization with these neuronal markers. Similarly, when using glial fibrillary acidic protein (GFAP) as a marker for glial cells, AGPAT4 is also detectable in GFAP-positive cells . The protein exhibits a characteristic diffuse, punctate staining pattern, suggesting potential association with specific subcellular compartments, consistent with its reported mitochondrial localization in certain contexts.

What expression systems are optimal for producing Recombinant Macaca fascicularis AGPAT4?

Multiple expression systems have been validated for the production of Recombinant Macaca fascicularis AGPAT4, each with distinct advantages depending on research requirements. The following expression systems have been documented:

Expression SystemProduct Code ExampleAdvantages
In vitro E. coliCSB-CF700146MOVCost-effective, high yield, suitable for structural studies
YeastCSB-YP700146MOV1Post-translational modifications, proper folding
BaculovirusCSB-BP700146MOV1Eukaryotic processing, high expression levels
Mammalian cellCSB-MP700146MOV1Native-like post-translational modifications
In Vivo Biotinylation in E. coliCSB-EP700146MOV1-BFacilitates purification and detection strategies

When designing experiments requiring recombinant AGPAT4, researchers should select the expression system based on downstream applications. For basic biochemical characterization, E. coli-expressed protein may be sufficient, while applications requiring proper folding and post-translational modifications might benefit from mammalian or baculovirus expression systems .

How should primary neural cultures be prepared to study AGPAT4 localization and function?

For studying AGPAT4 in neural contexts, the following protocol has been validated: Harvest fetal mouse brains at embryonic day E18.5, dissect in cold HBSS medium supplemented with 30 mM HEPES, 0.6% w/v glucose, and 2% w/v sucrose (pH 7.4). Isolate the cortex and digest with pre-warmed 0.25% trypsin-EDTA for 20 minutes at 37°C. Following centrifugation at 1000 g for 5 minutes, resuspend the pellet in plating media (DMEM/F12 with 10% horse serum, 10% FBS, and 1% penicillin-streptomycin) .

Filter the homogenate using a 100 μm nylon cell strainer, and seed the cells onto glass coverslips pretreated with poly-D-lysine. After allowing cells to attach for 3 hours, replace 50% of the plating media with feeding media (Neurobasal media supplemented with 1% B27) to promote neuronal differentiation . This preparation yields mixed cultures of cortical neurons and glial cells suitable for immunohistochemical analysis of AGPAT4 expression and localization using appropriate antibodies.

How does AGPAT4 contribute to phospholipid synthesis during critical developmental windows?

The differential expression of AGPAT4 during embryogenesis correlates with periods of rapid cellular growth and organogenesis, particularly in the central nervous system. The significant upregulation at E14.5 coincides with peak neurogenesis in mice, suggesting a potential role in membrane expansion required for neuronal development . AGPAT4's enzymatic function converts lysophosphatidic acid to phosphatidic acid, providing a critical intermediate for the synthesis of various phospholipids essential for membrane biogenesis.

The dramatic downregulation observed by E18.5 may indicate that AGPAT4's role becomes less critical as development progresses toward birth, or that its function becomes more specialized or compartmentalized. This temporal regulation pattern suggests that AGPAT4 might be particularly important during the formation of neural networks rather than in their maintenance. Future research could explore whether artificially maintaining high AGPAT4 expression beyond E14.5 affects neuronal development or function.

What methodological approaches can resolve the subcellular localization of AGPAT4 in neurons versus glial cells?

To precisely determine AGPAT4 subcellular localization in different neural cell types, researchers should employ confocal fluorescence microscopy with co-localization studies using cell-type-specific markers. The following immunofluorescence protocol has proven effective: Fix cells with 4% paraformaldehyde for 10 minutes, permeabilize with 0.5% Triton X-100 for 5 minutes, and block with 5% goat IgG serum .

For neuron-specific analysis, use rabbit anti-AGPAT4 antibody (1:100 dilution) in combination with mouse anti-NESTIN antibodies (1:500) or Neurotrace 500/525 Green Fluorescent Nissl Stain. For glial cells, combine anti-AGPAT4 with mouse anti-GFAP (1:500). Visualize using appropriate secondary antibodies such as Alexa Fluor 488-conjugated anti-mouse IgG .

To extend beyond this basic co-localization, super-resolution microscopy techniques such as STORM or PALM could provide nanometer-scale resolution of AGPAT4 distribution. Additionally, subcellular fractionation followed by western blotting could biochemically confirm the mitochondrial localization previously reported and determine if this localization differs between cell types.

How might functional differences of AGPAT4 between primates and rodents impact translational research?

While the basic enzymatic function of AGPAT4 is conserved across species, subtle differences in protein structure, regulation, or interaction partners between primates (like Macaca fascicularis) and rodents could influence experimental outcomes in translational research. Researchers should consider several methodological approaches to address these potential differences:

  • Comparative enzyme kinetics assays using recombinant AGPAT4 from both species to identify functional differences in substrate specificity or catalytic efficiency.

  • Proteomic analysis to identify species-specific interaction partners that might influence AGPAT4 function in different cellular contexts.

  • Cross-species complementation studies where the endogenous gene is knocked down and replaced with the ortholog from another species to assess functional conservation.

The availability of recombinant proteins from both Macaca fascicularis (CSB-CF700146MOV) and mouse (CSB-CF815685MO) facilitates such comparative studies . Understanding these species-specific differences is crucial when extrapolating findings from rodent models to primate systems, especially when considering AGPAT4 as a potential therapeutic target for neurological disorders.

What are the optimal protocols for quantifying AGPAT4 expression levels in tissue samples?

For accurate quantification of AGPAT4 expression in tissue samples, researchers should employ a combination of RNA and protein detection methods:

For mRNA quantification, the following RT-qPCR protocol has been validated: Extract total RNA using TRIzol Reagent, synthesize cDNA from 2 μg RNA using oligo(dT) priming with SuperScript II Reverse Transcriptase. Perform qPCR using AGPAT4-specific TaqMan assays (such as Mm00509777_m1 for mouse Agpat4) with appropriate reference genes (18S rRNA, Mm04277571_s1) . Normalize expression using the ΔΔCt method.

For protein detection, western blotting using validated anti-AGPAT4 antibodies provides quantitative data when coupled with appropriate loading controls. For tissue-specific localization, immunohistochemistry with specific markers for cell types of interest allows visualization of expression patterns within complex tissues.

When analyzing developmental expression patterns, it's critical to collect samples at multiple timepoints. As demonstrated in murine studies, AGPAT4 expression varies dramatically across embryonic development, with a 3.7-fold increase from E10.5 to E14.5, followed by a reduction to 4% of peak levels by E18.5 .

How can researchers distinguish between AGPAT4 and other AGPAT family members in functional studies?

Distinguishing between AGPAT4 and other AGPAT family members (AGPAT1-11 in mammals) requires careful methodological approaches:

  • Specificity of detection reagents: Use highly specific antibodies validated against multiple AGPAT isoforms. When available, use the AGPAT4 antibodies with confirmed specificity (such as CSB-PA003161 or CSB-PA445497) .

  • Gene-specific knockdown/knockout: Employ siRNA/shRNA targeting unique regions of AGPAT4 mRNA or CRISPR-Cas9 gene editing to create specific AGPAT4 knockdowns or knockouts.

  • Substrate preference analysis: Compare enzymatic activities using various acyl-CoA donors and lysophospholipid acceptors, as AGPAT4 may have distinct substrate preferences compared to other family members.

  • Subcellular localization: AGPAT4 has been identified as a mitochondrial enzyme, while other AGPAT family members may localize to different subcellular compartments. Fractionation studies followed by immunoblotting can help distinguish based on localization patterns.

When interpreting functional data, researchers should consider potential compensatory mechanisms from other AGPAT family members, which may mask phenotypes in single-gene manipulation studies.

What are promising approaches for investigating AGPAT4's role in neurological disorders?

Given AGPAT4's expression in both neurons and glial cells and its dynamic regulation during brain development, several approaches could elucidate its potential role in neurological disorders:

  • Comparative expression studies in post-mortem brain tissues from patients with neurodevelopmental or neurodegenerative disorders versus healthy controls.

  • Generation of conditional knockout mouse models where AGPAT4 is selectively deleted in neurons or glial cells to assess cell-type-specific functions.

  • Pharmacological inhibition of AGPAT4 in neural cultures to assess acute effects on lipid metabolism and cellular function.

  • Lipidomic analyses of brain regions in models with altered AGPAT4 expression to identify specific lipid species affected by AGPAT4 activity.

  • Electrophysiological studies to determine if AGPAT4 modulation affects neuronal signaling, potentially through alterations in membrane composition.

The temporal expression pattern of AGPAT4 during development (peaking at E14.5 in mice) suggests particular attention should be paid to neurodevelopmental disorders with origins in mid-gestation .

How might cross-species comparative studies of AGPAT4 inform evolutionary aspects of lipid metabolism?

The availability of recombinant AGPAT4 proteins from multiple species (human, mouse, rat, bovine, Macaca fascicularis, and Pongo abelii) provides a unique opportunity to investigate evolutionary aspects of lipid metabolism . Researchers could pursue several approaches:

  • Phylogenetic analysis of AGPAT4 sequences across species to identify conserved domains and species-specific variations.

  • Comparative enzymatic assays using recombinants from different species under identical conditions to assess functional conservation or divergence.

  • Expression pattern analysis across species to determine if developmental regulation is evolutionarily conserved.

  • Investigation of species-specific interaction partners that might reflect adaptation of lipid metabolism to different ecological niches.

  • Structural biology approaches to determine if subtle differences in protein structure correlate with functional adaptations.

Such comparative studies could provide insights into how lipid metabolism has evolved across mammalian lineages and potentially identify key adaptations in primate-specific brain development and function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.