Recombinant Macaca fascicularis 3-oxo-5-alpha-steroid 4-dehydrogenase 1 (SRD5A1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Steroid Metabolism

SRD5A1 catalyzes the NADPH-dependent reduction of testosterone to DHT and progesterone/corticosterone to their 5α-reduced metabolites. Its activity is pivotal for:

  • Androgen Physiology: Regulates sexual differentiation and tissue-specific androgen signaling .

  • Vascular Remodeling: In murine models, SRD5A1 deficiency impairs decidualization and vascular permeability during pregnancy, linked to downregulated angiogenic genes (Pecam1, Flt1) and dysregulated VEGF pathways .

  • Drug Interactions: Targeted by inhibitors like finasteride and dutasteride for conditions such as benign prostatic hyperplasia .

Research Applications

Recombinant SRD5A1 is utilized in:

  • Enzyme Activity Assays: Quantifying 5α-reductase inhibition or activation using substrates like testosterone .

  • Protein-Protein Interaction Studies: Demonstrated binding to 17-beta-hydroxysteroid dehydrogenase type 3 (HSD17b3) via ELISA (EC₅₀ = 0.03 µg/mL) .

  • Antibody Production: Serves as an immunogen for polyclonal antibody development .

Comparative Analysis of Recombinant SRD5A1 Products

Product IDSpeciesTagApplications
RFL399MF Macaca fascicularisHisStructural studies, activity assays
APM286Mu01 Mus musculusNoneCell culture, binding assays
CSB-CF635710MOV Macaca fascicularisUndeterminedELISA, immunogen development

Stability and Handling Guidelines

  • Reconstitution: Avoid vortexing; gentle agitation in PBS (pH 7.4) is recommended .

  • Thermal Stability: <5% degradation after 48 hours at 37°C .

  • Storage: Aliquot to prevent freeze-thaw cycles; working aliquots stable at 4°C for one week .

Research Findings and Implications

  • Decidualization Defects: Srd5a1 knockout mice exhibit impaired uterine decidualization and increased vascular permeability, highlighting its role in reproductive biology .

  • Therapeutic Targeting: Pharmacologic inhibition (e.g., finasteride) shows partial efficacy in modulating enzyme activity, though chronic ablation is required for pronounced effects .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery timeframe.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. Should you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, it is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To ensure long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C, while the lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain product integrity, avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
SRD5A1; 3-oxo-5-alpha-steroid 4-dehydrogenase 1; SR type 1; Steroid 5-alpha-reductase 1; S5AR 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-263
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
SRD5A1
Target Protein Sequence
MATAVAEELLLAEERMLAALAYLQCAVGCAVLARNRETNLAYGRHASPSFRVRVPARAAW VVQELPSLALPLYQYASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLA CTMAIMFCTFNGYLQSRYLSHWAVYADDWVTDPRFLIGFGLWLAGMLINIHSDHILRNLR KPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEH HRWYLQKFEEYPKFRKILIPFLF
Uniprot No.

Target Background

Function
This enzyme catalyzes the conversion of testosterone to 5-alpha-dihydrotestosterone and progesterone or corticosterone to their corresponding 5-alpha-3-oxosteroids. SRD5A1 plays a crucial role in sexual differentiation and androgen physiology.
Database Links

KEGG: mcf:102126671

UniGene: Mfa.6683

Protein Families
Steroid 5-alpha reductase family
Subcellular Location
Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SRD5A1 and what are its primary functions in mammalian physiology?

SRD5A1 (3-oxo-5-alpha-steroid 4-dehydrogenase 1) is a steroidogenic enzyme responsible for the conversion of testosterone to dihydrotestosterone (DHT), which is essential for healthy ovarian follicle growth. In the brain, this enzyme catalyzes the production of neurosteroids by converting deoxycorticosterone and progesterone to their 5α-reduced forms. These are subsequently converted to tetrahydrodeoxycorticosterone and allopregnanolone, which regulate the hypothalamic-pituitary-adrenal and gonadal axes . SRD5A1 plays important roles in stress response and likely contributes to early life programming of these endocrine axes. The enzyme is expressed in multiple tissues including skin, hypothalamus, and ovaries, with expression patterns that vary throughout development .

Methodologically, when studying SRD5A1 function across species, researchers should consider tissue-specific expression patterns and developmental stages, as these factors significantly impact enzyme activity and physiological outcomes. Experiments should be designed to account for these variables by carefully selecting appropriate developmental timepoints and conducting parallel analyses across multiple tissues of interest.

What is the molecular structure of SRD5A1, and how does it influence function?

The molecular structure of SRD5A1 reflects its membrane-bound nature and enzymatic function. The full-length cDNA sequence typically contains an ORF of approximately 795 bp, translating into 265 amino acids . Signal peptide analysis reveals that SRD5A1 is a non-secretory protein with a hydrophobic nature, consistent with its membrane localization .

Three-dimensional structural analysis shows that SRD5A1 contains seven transmembrane helices connected by six loops, with the N-termini located on the periplasmic side and C-termini on the cytosolic side . Electrostatic potential calculations reveal a large cavity with two openings: one highly electropositive facing the cytosolic side and another relatively neutral towards the transmembrane region . This structural arrangement facilitates binding of NADPH at the electropositive side and steroid hormone substrates in the hydrophobic environment.

Critical functional residues include E66 and Y101, which are conserved and involved in hydrogen bonding with the ketone group at C-3 in steroids, facilitating Δ4 double-bond reduction . These structural characteristics directly influence the enzyme's substrate specificity and catalytic efficiency.

How is SRD5A1 expression regulated during development and across different tissues?

SRD5A1 expression demonstrates dynamic tissue-specific regulation throughout development. In murine ovaries, SRD5A1 mRNA expression increases approximately 8-fold between postnatal days 10 and 30, coinciding with rising estradiol (E2) levels during the prepubertal stage . This developmental pattern correlates with decreasing methylation of specific CpG sites in the first intron of the gene, with methylation decreasing by up to 75% during this period .

In contrast, hypothalamic preoptic area (POA) expression follows a different pattern, with SRD5A1 mRNA levels decreasing by 70% between postnatal days 7 and 10 and then remaining relatively constant . Unlike in ovarian tissue, this change does not correlate with CpG methylation levels in the POA.

The regulatory mechanisms also differ between tissues. In ovarian cells, estradiol exposure increases SRD5A1 expression, while in hypothalamic cells, glucocorticoids (such as dexamethasone) reduce expression levels . These tissue-specific differences highlight the importance of context when studying SRD5A1 regulation.

TissueAge/StageSRD5A1 Expression ChangeMethylation ChangeRegulatory Factor
OvaryPND 10→30↑ 8-fold↓ 75% at specific CpGsEstradiol (↑)
Hypothalamic POAPND 7→10↓ 70%No correlationGlucocorticoids (↓)

What experimental techniques are most effective for studying recombinant SRD5A1 expression?

When expressing and studying recombinant SRD5A1, several methodological approaches have proven effective. For expression analysis, quantitative RT-PCR using validated primer sets is recommended, with multiplexing capability demonstrated for SRD5A1 and housekeeping genes like cyclophilin . When designing primers, researchers should target conserved regions across species while accounting for any Macaca fascicularis-specific variations.

For protein expression and detection, epitope tagging approaches have proven valuable. Previous studies have successfully used V5-epitope tags at the C-terminus of SRD5A1, with detection via anti-V5 antibodies . This approach circumvents potential issues with commercially available SRD5A1 antibodies, which may have variable specificity across species.

Expression vector selection is crucial for successful recombinant expression. Plasmid vectors such as pcDNA/V5-His have been successfully employed for SRD5A1 expression in mammalian cells . Transformation protocols typically involve heat-shock methods (42°C for 45 seconds) when using competent bacterial cells for plasmid propagation.

For transfection into mammalian cells, lipid-based methods such as Lipofectamine 2000 have demonstrated efficacy, with optimal results achieved using approximately 0.5 μg of purified plasmid per transfection . Cell culture conditions should be optimized for the specific cell line, with media changes 24 hours before experimental treatments when studying hormone responses.

How do epigenetic mechanisms regulate SRD5A1 expression, and how can these be experimentally manipulated?

Epigenetic regulation of SRD5A1 involves complex methylation patterns that exhibit tissue specificity. While the promoter of SRD5A1 (encompassed by a CpG island) remains unmethylated in certain tissues, the "shore" in the 5′ end of the first intron shows variable methylation that correlates with expression levels . These shores, with lower CpG density at the margins of CpG islands, display methylation patterns that are often conserved across species and tissues, and are closely associated with transcriptional repression .

Experimental manipulation of SRD5A1 methylation can be achieved through targeted approaches. Chromatin immunoprecipitation (ChIP) assays have confirmed estrogen receptor (ESR1) binding to differentially methylated regions in ovarian cells, with enrichment of the enhancer modification H3K4me1 . The CRISPR-Cas9 system has been adapted for targeted epigenetic modifications, with dCas9-DNMT3 successfully increasing CpG methylation 2.5-fold at specific sites, abolishing estradiol-mediated SRD5A1 response . Conversely, dCas9-TET1 has been employed to reduce CpG methylation by approximately 50% .

When designing experiments to study SRD5A1 epigenetic regulation, researchers should carefully select cell lines that maintain tissue-specific regulatory mechanisms. For instance, the KK-1 granulosa cell line has been successfully used for ovarian SRD5A1 studies, while GT1-7 cells serve as an appropriate model for hypothalamic regulation . These methodological considerations ensure that observed epigenetic changes reflect physiologically relevant regulatory mechanisms.

What are the key considerations when comparing SRD5A1 function across different species, particularly between human and non-human primates?

Cross-species analysis of SRD5A1 requires careful consideration of evolutionary conservation and divergence. Structural studies using AlphaFold 2 predictions have demonstrated high structural similarity between bacterial, human, and other vertebrate SRD5A1 proteins, particularly in the transmembrane domains and catalytic regions . This conservation suggests functional similarity, but species-specific variations may influence substrate affinity and catalytic efficiency.

When comparing Macaca fascicularis SRD5A1 with human orthologs, researchers should focus on several key aspects:

  • Sequence homology analysis of coding regions and regulatory elements

  • Conservation of critical functional residues (e.g., E66 and Y101 for steroid binding)

  • Expression patterns across comparable tissues and developmental stages

  • Substrate specificity and enzyme kinetics

  • Response to regulatory factors like steroids and stress hormones

Methodologically, comparative studies benefit from parallel analysis using identical experimental conditions. When designing primers or antibodies for cross-species studies, targeting highly conserved regions improves reliability. For functional comparisons, standardized enzyme activity assays using the same substrates and analytical methods ensure comparable results.

The presence of species-specific post-translational modifications or splice variants should be investigated, as these may contribute to functional differences despite high sequence conservation. For Macaca fascicularis specifically, researchers should account for potential differences in steroid metabolism pathways that may influence the physiological roles of SRD5A1.

How can SRD5A1 knockdown or inhibition be optimally achieved in research models?

Multiple approaches have been developed for effective SRD5A1 inhibition or knockdown, each with methodological considerations for optimal results. siRNA-mediated silencing has successfully reduced SRD5A1 transcripts to approximately 10% of control levels in human cell lines . When designing siRNA experiments, multiple target sequences should be tested to identify those with greatest knockdown efficiency, and effects should be confirmed at both mRNA and protein levels.

Inhibition MethodEfficiencyValidation ApproachConsiderations
siRNA transfectionReduces transcripts to ~10% of controlqRT-PCR and western blotCell type-specific optimization required
4-azasteroidsSpecific inhibition of enzymatic activityEnzyme activity assaysMay have limited effect on proliferation in certain cell types
CRISPR-Cas9 knockoutComplete gene inactivationGenomic PCR, sequencingPotential for off-target effects
dCas9-DNMT3 (epigenetic)Increases CpG methylation 2.5-foldMethylation analysis, expression studiesSite-specific targeting required

CRISPR-Cas9 approaches offer more permanent gene modification options, while epigenetic modulation using tools like dCas9-DNMT3 provides reversible regulation through methylation changes . The choice between these methods depends on research objectives and model systems, with consideration for potential compensatory mechanisms that may emerge with long-term inhibition.

What role does SRD5A1 play in pathological conditions, and how might recombinant SRD5A1 contribute to therapeutic development?

In reproductive disorders, SRD5A1 has been suggested to contribute to the pathogenesis of polycystic ovary syndrome, though evidence is still emerging . Its role in converting testosterone to DHT, required for healthy ovarian follicle growth, suggests that dysregulation could impact reproductive function .

Recombinant Macaca fascicularis SRD5A1 offers several potential applications in therapeutic development:

  • As a screening platform for novel inhibitors with improved specificity

  • For structural studies to identify species-specific binding interactions

  • To investigate stereoselective metabolism of potential drug candidates

  • For development of monoclonal antibodies targeting SRD5A1-overexpressing tumors

Methodologically, researchers developing therapeutic approaches should consider tissue-specific regulation patterns and potential compensatory mechanisms. For example, the differential regulation by estradiol in ovarian tissue versus glucocorticoid regulation in the hypothalamus necessitates tissue-targeted approaches . Therapeutic strategies should also account for the methylation-sensitive nature of SRD5A1 expression, as epigenetic modulators might offer alternative intervention approaches.

What are the most effective protocols for purification and functional characterization of recombinant Macaca fascicularis SRD5A1?

Purification of functional recombinant SRD5A1 presents technical challenges due to its hydrophobic nature and multiple transmembrane domains. Based on successful approaches with related proteins, the following methodological considerations are recommended:

Epitope tagging strategies, such as C-terminal V5 or polyhistidine tags, facilitate both detection and purification . For optimal results, the tag position should be carefully selected to minimize interference with protein folding or enzymatic activity. Dual tagging approaches (e.g., FLAG and His tags) can enable sequential purification steps for increased purity.

Detergent selection is critical for solubilization while maintaining enzymatic activity. Mild non-ionic detergents like DDM (n-dodecyl β-D-maltoside) or digitonin often provide a good balance between solubilization efficiency and protein stability. Nanodiscs or styrene-maleic acid lipid particles (SMALPs) represent alternative approaches for maintaining SRD5A1 in a near-native lipid environment.

Functional characterization requires assessing both binding affinity and catalytic activity. Radiolabeled substrate binding assays or surface plasmon resonance can evaluate substrate interactions, while HPLC or mass spectrometry-based methods can quantify conversion of testosterone to DHT or other relevant substrates. Thermal stability assays using differential scanning fluorimetry can assess protein quality and ligand interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.