Recombinant Macaca fascicularis Bestrophin-1 (BEST1)
Shipped with Ice Packs 
In Stock 
Description
Production and Purification
Recombinant Macaca fascicularis BEST1 is typically expressed in E. coli systems to ensure high yield and cost-effectiveness. Key steps include:
-
Vector Design: Full-length BEST1 cDNA cloned into expression vectors with N-terminal His-tags for affinity purification .
-
Expression: Induced in E. coli under optimized conditions (e.g., IPTG induction).
-
Purification: Nickel-affinity chromatography followed by dialysis to remove endotoxins .
Ion Channel Dynamics
Recombinant BEST1 enables electrophysiological studies to dissect its role as a Ca²⁺-activated Cl⁻ channel. Key findings include:
Disease Modeling
-
Bestrophinopathies: Over 200 BEST1 mutations cause retinal degenerations. Recombinant cynomolgus BEST1 aids in:
Table 3: Key Mutational Studies Using Recombinant BEST1
| Mutation | Functional Defect | Therapeutic Approach | Reference |
|---|---|---|---|
| P274R | Loss of Cl⁻ current | Viral gene supplementation | |
| Y227N | Dominant-negative effect on WT channels | CRISPR knockdown + gene augmentation |
Comparative Analysis with Other Species
Cynomolgus BEST1 aligns closely with human and murine homologs, enabling cross-species translational research:
Challenges and Future Directions
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request whenever possible.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
BEST1; VMD2; QtsA-19642; Bestrophin-1; Vitelliform macular dystrophy protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-585
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
BEST1
Target Protein Sequence
MTITYTSQVANARLGSFSRLLLCWRGSIYKLLYGEFFIFLLCYYIIRFIYRLALTEEQQL
MFEKLTLYCDSYIQLIPISFVLGFYVTLVVTRWWNQYENLPWPDRLMSLVSGFVEGKDEQ
GRLLRRTLIRYANLGNVLILRSVSTAVYKRFPSAQHLVQAGFMTPAEHKQLEKLSLPHNM
FWVPWVWFANLSMKAWLGGRIRDPILLQSLLNEMNTLRTQCGHLYAYDWISIPLVYTQVV
TVAVYSFFLTCLVGRQFLNPAKAYPGHELDLVVPVFTFLQFFFYVGWLKVAEQLINPFGE
DDDDFETNWIVDRNLQVSLLAVDEMHQDLPRMEPDMYWNEPEPHPPYTAASAQFRRASFM
GSTFNISLNKEEMEFQPNQEDKEDAHTGIIGRFLGLQSHDHHPPGANSRTKLLWPKRESL
LHEGLPKNHKAVKQNVRGLEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFP
PEPSVLSKLHSVTGIDTKDKSLKTVSSGAKNSSELLSGSDGALMEHPEVSHVRRKTVEFN
LTDMPEIPENHLKEPLELSTTNIHATLKDHVDPYWALENRDEAHS
Uniprot No.
Target Background
Function
Forms calcium-sensitive chloride channels. Permeable to bicarbonate.
Database Links
KEGG: mcf:101925702
UniGene: Mfa.6264
Protein Families
Bestrophin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Basolateral cell membrane.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
