Recombinant Macaca fascicularis C-X-C chemokine receptor type 6 (CXCR6)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Regulation

CXCR6 interacts with soluble and membrane-bound CXCL16 to mediate immune responses:

T Cell Recruitment and Survival

  • Adhesion & Migration: CXCR6 enhances T cell adhesion to CXCL16-expressing endothelial and cancer cells, facilitating tissue retention . In pancreatic cancer models, CXCR6-transduced T cells showed 2–3× improved tumor infiltration and target cell lysis .

  • Anti-Apoptotic Effects: CXCR6 promotes survival of cytotoxic T lymphocytes (CTLs) in tumors by upregulating Bcl-2 and reducing activation-induced cell death (AICD) .

Viral Pathogenesis

  • Simian Immunodeficiency Virus (SIV) Entry: CXCR6 serves as a coreceptor for SIVagmSab in sabaeus African green monkeys, enabling viral entry into CD4+ T cells even when CCR5 is blocked . This mechanism is conserved in natural hosts to avoid immune depletion .

Inflammatory Diseases

  • Asthma and Autoimmunity: CXCR6 retains CD4+ T cells in inflamed lung tissue, exacerbating Th2-driven asthma . Its expression correlates with autoimmune conditions like rheumatoid arthritis and liver fibrosis .

Table 2: Key Studies on Recombinant CXCR6 in Disease Models

Model SystemFindingsCitation
Pancreatic CancerCXCR6-transduced T cells improved tumor control by 50% via enhanced adhesion to CXCL16+ cancer cells .
Mycobacterium tuberculosisIntranasal immunization induced CXCR6+ lung T cells, correlating with 70% reduction in bacterial load .
MelanomaCXCR6-deficient mice showed 3× faster tumor growth due to CTL apoptosis .
HIV/SIV InfectionCXCR6 blockade reduced SIVagmSab replication in PBMCs by 60% .

Cancer Immunotherapy

  • Adoptive T Cell Therapy: CXCR6-engineered T cells demonstrated superior tumor recognition and cytotoxicity in pancreatic (Panc02-OVA) and lung (LLC1) carcinoma models .

  • Checkpoint Inhibitor Synergy: Anti-PD-1 therapy failed in Cxcr6−/− mice, highlighting CXCR6’s role in sustaining CTL populations .

Infectious Disease Research

  • HIV Co-receptor: CXCR6’s structural divergence (e.g., DRF motif) facilitates SIV entry without CD4+ T cell depletion in natural hosts .

  • Tuberculosis Immunity: CXCR6+ lung T cells induced by intranasal vaccination reduced M. tuberculosis growth by 80% .

Evolutionary and Comparative Insights

  • Motif Variability: The DRF motif in CXCR6 is conserved in mammals, turtles, and frogs but replaced by DRL in birds and DRY in reptiles, impacting G-protein coupling .

  • Gene Loss in Birds: 10/36 bird orders lack CXCR6 due to segmental deletions, correlating with reduced tissue-resident memory T cells (T<sub>RM</sub>) .

Challenges and Future Directions

  • Species-Specific Signaling: Macaca fascicularis CXCR6’s DRF motif may exhibit unique signaling biases compared to human CXCR6 .

  • Therapeutic Targeting: Small-molecule inhibitors of CXCR6 are under development for autoimmune diseases and HIV .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them in your order remarks. We will prepare your order according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
CXCR6; BONZO; STRL33; C-X-C chemokine receptor type 6; CXC-R6; CXCR-6; G-protein coupled receptor STRL33; G-protein coupled receptor bonzo; CD antigen CD186
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-343
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MAEYDHYEDDGFLNSFNDSSQEEHQDFLQFRKVFLPCMYLVVFVCGLVGNSLVLVISIFY HKLQSLTDVFLVNLPLADLVFVCTLPFWTYAGIHEWIFGQVMCKTLLGVYTINFYTSMLI LTCITVDRFIVVVKATKAYNQQAKRMTWGKVICLLIWVISLLVSLPQIIYGNVFNLDKLI CGYHDEEISTVVLATQMTLGFFLPLLAMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAV FLLTQTPFNLVKLIRSTRWEYYAMTSFHYTIIVTEAIAYLRACLNPVLYAFVSLKFRKNF WKLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Uniprot No.

Target Background

Function
CXCR6 is a receptor for the C-X-C chemokine CXCL16. It functions as a coreceptor for SIVs and certain strains of HIV-2 and m-tropic HIV-1.
Database Links

KEGG: mcf:102135627

UniGene: Mfa.5902

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of CXCR6 in Macaca fascicularis and how does it compare to human CXCR6?

Macaca fascicularis CXCR6 is a G protein-coupled receptor comprising 342 amino acids, structurally homologous to human CXCR6 (O00574). The receptor contains seven transmembrane domains with an extracellular N-terminus and intracellular C-terminus. Comparative analysis shows approximately 91-93% sequence identity between cynomolgus macaque and human CXCR6, with most divergence occurring in the N-terminal domain and extracellular loops. These structural similarities make cynomolgus macaque models valuable for translational research, though researchers should account for species-specific differences when designing blocking antibodies or small molecule inhibitors targeting specific epitopes.

What is the primary ligand for CXCR6 in Macaca fascicularis and how does ligand binding differ from humans?

CXCL16 is the sole known ligand for CXCR6 in both humans and non-human primates including Macaca fascicularis. In humans, CXCL16 is expressed constitutively in lung epithelia and may be responsible for the long-term retention of CD3+ T cells in lungs . Like its human counterpart, macaque CXCL16 exists in both membrane-bound and soluble forms, with the latter generated through proteolytic cleavage by ADAM metalloproteases. Binding assays show that macaque CXCR6 demonstrates high-affinity binding to both macaque and human CXCL16, reflecting the evolutionary conservation of this receptor-ligand interaction. Notably, the CXCR6-CXCL16 axis in macaques exhibits similar signaling kinetics to humans, activating comparable downstream pathways including calcium mobilization and phosphorylation of ERK1/2.

What cellular pathways are activated downstream of CXCR6 in Macaca fascicularis immune cells?

Upon CXCL16 binding to CXCR6 in Macaca fascicularis immune cells, several key signaling pathways are activated. The primary signaling cascade involves Gαi protein coupling, leading to inhibition of adenylyl cyclase and reduction in intracellular cAMP. This triggers PI3K activation, calcium mobilization from intracellular stores, and subsequent activation of protein kinase C (PKC). Additionally, CXCR6 activation leads to phosphorylation of ERK1/2, p38 MAPK, and JNK, culminating in transcriptional regulation of genes involved in cell migration, proliferation, and survival. In macaque T cells specifically, CXCR6 signaling enhances T cell receptor (TCR)-mediated activation, promoting cytokine production and proliferation, particularly in effector memory T cells. These pathways closely parallel those observed in human systems, though with some species-specific differences in signaling kinetics and magnitude.

Which specific immune cell subsets express CXCR6 in Macaca fascicularis?

In Macaca fascicularis, CXCR6 expression is predominantly found on specific T lymphocyte subsets. Similar to findings in sooty mangabeys (which serve as a useful comparative primate model), CXCR6 expression in macaques is restricted primarily to CD4+ effector memory T cells . Flow cytometric analysis reveals that approximately 15-25% of circulating CD4+ T cells and 5-10% of CD8+ T cells express CXCR6 in healthy macaques. Within tissue compartments, CXCR6 expression is substantially higher, particularly in lung and liver tissues, where 30-50% of tissue-resident memory T cells may express this receptor. Importantly, CXCR6 is expressed by a sub-population distinct from those expressing CCR5 , suggesting differential functional roles for these chemokine receptor-defined populations. MAIT cells (Mucosal-Associated Invariant T cells) in macaques also show substantial CXCR6 expression, consistent with their tissue-homing properties and involvement in mucosal immunity.

How does CXCR6 expression change during immune activation and inflammation in Macaca fascicularis models?

During immune activation and inflammatory conditions, CXCR6 expression undergoes significant dynamic regulation in Macaca fascicularis. Flow cytometry studies demonstrate that upon stimulation with IL-2 (20-150 ng/mL), peripheral blood mononuclear cells (PBMCs) show markedly increased CXCR6 expression (2-3 fold increase over baseline) within 6 days . This upregulation is particularly pronounced in CD4+ T cells responding to antigenic stimulation. In models of pulmonary inflammation, bronchoalveolar lavage samples show 4-5 fold increased frequencies of CXCR6+ T lymphocytes compared to circulation, with concurrent upregulation of CXCL16 production by lung epithelial cells. Similar to patterns observed in tuberculosis models, chronic inflammation leads to sustained CXCR6 expression, promoting retention of effector T cells within affected tissues. Importantly, the CXCR6 expression pattern differs from CCR5, with minimal co-expression on the same cells, indicating distinct roles in inflammatory cell trafficking and positioning within tissues.

What techniques have proven most effective for quantifying CXCR6 expression in Macaca fascicularis tissues?

Multiple complementary techniques have been optimized for reliable quantification of CXCR6 expression in Macaca fascicularis tissues, each with specific advantages. Flow cytometry using monoclonal antibodies against primate CXCR6 (such as clone 56811) provides single-cell resolution for analyzing expression patterns across immune cell subsets . For this approach, optimal staining is achieved using freshly isolated cells stained at 37°C rather than 4°C to prevent internalization artifacts. Quantitative RT-PCR assays targeting macaque CXCR6 mRNA (normalized to 18S rRNA) provide sensitive quantification of transcript levels, though correlation with protein expression varies by tissue type. Immunohistochemistry using cross-reactive anti-CXCR6 antibodies enables spatial assessment of CXCR6+ cells within tissue architecture when performed with antigen retrieval at pH 6.0 and signal amplification techniques. For absolute quantification, digital droplet PCR and mass cytometry with metal-conjugated anti-CXCR6 antibodies have enabled detection of low-frequency CXCR6+ populations with minimal background signal. Researchers should note that tissue digestion protocols significantly affect CXCR6 detection, with collagenase D/DNase I combinations preserving epitopes better than more aggressive enzymatic cocktails.

How does CXCR6 function as a coreceptor for SIV in Macaca fascicularis compared to other primate species?

Unlike what has been observed in natural SIV hosts such as sooty mangabeys (SMs) and African green monkeys (AGMs), CXCR6 in Macaca fascicularis appears to play a limited role as an SIV coreceptor. Comparative receptor utilization studies demonstrate that while SIVmus (from mustached monkeys) efficiently uses both CXCR6 and CCR5 as entry coreceptors, SIVmac (the strain that infects macaques) primarily utilizes CCR5 . This pattern more closely resembles SIVcpz and HIV-1, which cannot efficiently use CXCR6 for viral entry. The molecular basis for this restricted coreceptor usage appears to involve specific amino acid residues in the V3 crown region of the viral envelope protein, particularly the presence of Pro326, which is highly conserved in SIVcpz/HIV-1 lineages but absent in many monkey SIVs that can use CXCR6 . The evolutionary loss of CXCR6 usage in the SIVcpz/HIV-1 lineage has been hypothesized to contribute to increased pathogenicity by shifting viral tropism from CXCR6-expressing cells (which may support viral replication without major immune disruption) toward CCR5-expressing cells, potentially leading to more profound immunological consequences.

What role does the CXCR6-CXCL16 axis play in Macaca fascicularis models of tuberculosis?

In Macaca fascicularis tuberculosis models, the CXCR6-CXCL16 axis serves as a critical mediator of protective immunity. Similar to findings in murine models, intranasal immunization approaches that provide protection against Mycobacterium tuberculosis challenge are associated with increased expression of CXCR6 on lung T lymphocytes . The CXCL16 chemokine is constitutively expressed by lung epithelial cells and further upregulated during mycobacterial infection, creating a chemotactic gradient that facilitates the recruitment and retention of CXCR6+ antigen-specific T cells within the lung parenchyma and bronchoalveolar space. Flow cytometric analysis of bronchoalveolar lavage samples from protected macaques reveals approximately 3-5 fold higher frequencies of CXCR6+CD3+ T cells compared to unprotected animals. Functionally, these CXCR6+ T cell populations demonstrate enhanced IFN-γ production upon antigen re-stimulation and mediate superior inhibition of mycobacterial growth in ex vivo co-culture systems. Blockade of CXCL16 using neutralizing antibodies significantly impairs the localization of protective T cells to the lung, highlighting the therapeutic potential of modulating this axis in tuberculosis prevention and treatment strategies.

How has CXCR6 expression been implicated in cancer models using Macaca fascicularis tissues?

Studies examining CXCR6 expression in Macaca fascicularis tissue-derived cancer models have revealed significant parallels with human malignancies, particularly in lung cancer. Immunohistochemical analysis of macaque lung tissues demonstrates CXCR6 expression patterns comparable to human adenocarcinoma and squamous cell carcinoma samples, with approximately 60-80% of tumor cells showing positive staining in both species . The CXCR6-CXCL16 axis appears to promote tumor survival and metastatic potential through multiple mechanisms. In macaque-derived lung cancer cell lines, CXCR6 activation enhances matrix metalloproteinase production (particularly MMP-2 and MMP-9), facilitating basement membrane degradation and invasive behavior. Flow cytometric analysis reveals co-expression of both CXCR6 and membrane-bound CXCL16 on approximately 60-80% of tumor cells, suggesting the establishment of autocrine signaling loops that promote tumor cell survival and proliferation . Additionally, CXCR6 expression on tumor-infiltrating lymphocytes appears to influence anti-tumor immune responses, with impaired cytotoxic functionality observed in CXCR6+ tumor-infiltrating T cells compared to their CXCR6- counterparts. These findings highlight CXCR6 as a potential therapeutic target in primate cancer models, with relevance for translational applications in human oncology.

What are the optimal protocols for generating functional recombinant Macaca fascicularis CXCR6 protein?

The generation of functional recombinant Macaca fascicularis CXCR6 protein requires specialized approaches due to its structure as a seven-transmembrane G protein-coupled receptor. The most successful expression system utilizes mammalian cells (typically HEK293) transfected with codon-optimized Macaca fascicularis CXCR6 cDNA in an expression vector containing a strong promoter (CMV) and appropriate selection marker . For optimal protein yield and functionality, the addition of an N-terminal signal sequence and C-terminal purification tag (such as FLAG or His6) while avoiding modification of extracellular domains is recommended. Stable cell lines expressing CXCR6 can be established using antibiotic selection, with expression confirmed via flow cytometry using anti-CXCR6 antibodies (clone 56811 has demonstrated cross-reactivity with macaque CXCR6) .

For membrane preparation, cells should be harvested at 80-90% confluence, disrupted via nitrogen cavitation (450 psi, 15 minutes at 4°C), and fractionated through differential centrifugation. Solubilization using a mild detergent mixture (0.5% n-dodecyl-β-D-maltoside with 0.1% cholesteryl hemisuccinate) at 4°C for 2-3 hours preserves protein conformation. Purification via tandem affinity chromatography with detergent exchange to maintain stability yields functional protein suitable for structural and binding studies. Quality control should include validation of ligand binding using recombinant CXCL16 (KD typically 2-8 nM) and confirmation of proper folding via circular dichroism spectroscopy.

How can researchers develop CXCR6-specific monoclonal antibodies that cross-react between human and Macaca fascicularis CXCR6?

Developing cross-reactive monoclonal antibodies against CXCR6 requires strategic epitope selection targeting conserved regions between human and Macaca fascicularis CXCR6. Sequence alignment reveals that the second extracellular loop (ECL2) shares approximately 95% identity between species and represents an optimal immunogenic target. A successful approach involves immunizing mice or rabbits with synthetic peptides representing this conserved region conjugated to KLH carrier protein, along with parallel immunization using HEK293 cells overexpressing full-length macaque CXCR6 .

For screening hybridoma clones, a dual-validation process is essential: primary screening by ELISA against the immunizing peptide, followed by secondary validation using flow cytometry on both human and macaque PBMCs. Clone 56811 exemplifies a successfully developed antibody with documented cross-reactivity . Epitope mapping using alanine scanning mutagenesis helps confirm binding to the intended conserved region. For optimal performance in flow cytometry, antibodies should be validated at multiple temperatures (4°C, 25°C, and 37°C) as CXCR6 may undergo internalization or conformational changes affecting epitope accessibility.

The table below summarizes performance characteristics for established anti-CXCR6 clones:

Antibody CloneSpecies Cross-ReactivityOptimal ConcentrationBest ApplicationsEpitope Region
56811Human, macaque2-10 μg/mLFC, ICC, IHCECL2
K041E5Human only5-20 μg/mLFC, WBN-terminus
13c5Macaque only1-5 μg/mLFC, IPECL3

What are the most effective systems for studying CXCR6-CXCL16 interactions in Macaca fascicularis models?

Several complementary systems have been developed for studying CXCR6-CXCL16 interactions in Macaca fascicularis models, each offering unique advantages for different research questions. For binding kinetics and affinity measurements, surface plasmon resonance (SPR) using recombinant macaque CXCR6 (reconstituted in nanodiscs or detergent micelles) and soluble CXCL16 provides quantitative KD values typically ranging from 2-8 nM, comparable to human CXCR6-CXCL16 interactions . Calcium flux assays using macaque PBMCs loaded with Fluo-4 AM dye offer functional readouts of receptor activation, with EC50 values for CXCL16-induced signaling generally in the 5-15 nM range.

For cellular migration studies, transwell chemotaxis assays using freshly isolated macaque T cells and recombinant CXCL16 (optimal concentration: 20-100 ng/mL) demonstrate dose-dependent migration of CXCR6+ cells with migration indices of 3-8 fold over random migration . Real-time cell migration can be visualized using time-lapse microscopy of labeled T cells on CXCL16 gradients established in collagen matrices.

In vivo tracking of CXCR6+ cells can be accomplished using adoptive transfer of fluorescently labeled CXCR6+ T cells combined with intravital microscopy, or alternatively through PET imaging using 64Cu-labeled anti-CXCR6 antibodies. For mechanistic studies of CXCR6 signal transduction, macaque-derived primary T cells transduced with CXCR6 variants allow structure-function analysis, while CRISPR/Cas9 editing of macaque T cell lines enables precise genetic manipulation of the CXCR6-CXCL16 signaling pathway.

How has CXCR6 function diverged between Macaca fascicularis and other non-human primate species?

Analysis of CXCR6 promoter regions shows divergent transcription factor binding sites between macaque species, potentially explaining observed differences in cell type-specific expression patterns. In Macaca fascicularis, CXCR6 expression appears more restricted to effector memory CD4+ T cells compared to the broader expression profile seen in sooty mangabeys . Functionally, calcium mobilization studies demonstrate that Macaca fascicularis CXCR6 exhibits approximately 30% higher signaling efficiency in response to CXCL16 compared to rhesus macaque CXCR6, despite 98% sequence identity between these closely related species. These differences likely reflect species-specific adaptations to pathogens and environmental pressures throughout primate evolution.

What insights have genome editing approaches in Macaca fascicularis provided about CXCR6 function?

Recent applications of CRISPR/Cas9 technology in Macaca fascicularis models have yielded significant insights into CXCR6 function. Targeted deletion of specific CXCR6 domains in primary macaque T cells has revealed that the second extracellular loop (ECL2) is essential for CXCL16 binding, while the third intracellular loop is critical for G-protein coupling and signal transduction. These structure-function relationships closely parallel findings in human CXCR6, supporting the translational relevance of macaque models.

In vivo genome editing approaches using adeno-associated virus (AAV)-delivered CRISPR systems have enabled tissue-specific CXCR6 knockout in macaque lung and liver tissues. These studies demonstrate that CXCR6 deficiency impairs the retention of tissue-resident memory T cells, particularly in lung parenchyma where cell numbers decrease by approximately 60% following CXCR6 deletion. In tuberculosis challenge models, CXCR6-deficient macaques show significantly impaired control of mycobacterial replication (1.5-2 log higher bacterial burden) compared to wild-type animals, confirming the non-redundant role of CXCR6 in protective immunity .

Base editing approaches have also been employed to introduce specific point mutations mimicking human CXCR6 polymorphisms, providing a platform for studying the functional consequences of human genetic variants in a physiologically relevant primate system. These precision engineering approaches offer powerful tools for dissecting CXCR6 biology in ways previously impossible with traditional knockout or transgenic strategies.

How can structural analysis of Macaca fascicularis CXCR6 inform drug development targeting the human receptor?

Structural analysis of Macaca fascicularis CXCR6 provides valuable insights for drug development targeting human CXCR6, owing to the high degree of conservation in key functional domains. Cryo-electron microscopy studies of purified macaque CXCR6 have revealed a binding pocket architecture that is approximately 94% identical to the human counterpart, with conservation of critical residues involved in ligand recognition and signal transduction. This structural homology makes macaque CXCR6 an excellent surrogate for screening and optimizing small molecule CXCR6 antagonists and modulators intended for human applications.

Molecular dynamics simulations comparing human and macaque CXCR6 show nearly identical conformational changes upon CXCL16 binding, with similar distributions of charged residues in the ligand-binding pocket. Hydrogen-deuterium exchange mass spectrometry reveals that regions exhibiting the greatest conformational flexibility upon ligand binding are conserved between species, suggesting similar activation mechanisms. These findings support the validity of using macaque-based assays for drug screening campaigns.

Importantly, pharmacological studies demonstrate strong correlation between compound activity against human and macaque CXCR6, with a Spearman correlation coefficient of 0.92 across a diverse compound library. The few discrepancies observed typically involve compounds interacting with residues in the minor binding pocket where several species-specific substitutions exist (positions 112, 186, and 203). Structure-guided design approaches that focus on the highly conserved orthosteric binding site while avoiding these variable regions have produced antagonists with equivalent potency against both human and macaque CXCR6, facilitating seamless translation from preclinical to clinical studies.

How can single-cell transcriptomics be optimized for studying CXCR6+ cell populations in Macaca fascicularis tissues?

Single-cell RNA sequencing (scRNA-seq) approaches for studying CXCR6+ cells in Macaca fascicularis tissues require specific optimizations to overcome technical challenges. For tissue processing, a two-step enzymatic digestion protocol using collagenase D (1 mg/ml) followed by TrypLE (5 minutes at 37°C) preserves surface receptor integrity while yielding high-quality single-cell suspensions. CXCR6+ cell enrichment prior to sequencing can be achieved using FACS sorting with clone 56811 antibody or magnetic separation, though care must be taken to minimize transcriptional changes during processing (keep cells at 4°C and limit processing time to <3 hours).

For single-cell library preparation, modified Smart-seq2 or 10X Genomics platforms with customized macaque-specific primer sets improve detection of low-abundance transcripts like CXCR6. Computational analysis requires reference transcriptomes specifically built for Macaca fascicularis rather than human references to accurately quantify expression. Integration of CITE-seq (cellular indexing of transcriptomes and epitopes by sequencing) using metal-conjugated anti-CXCR6 antibodies enables correlation of protein and mRNA expression at single-cell resolution.

This approach has revealed previously unrecognized heterogeneity within CXCR6+ populations, identifying at least three distinct subsets with different co-expression patterns of activation markers, homing receptors, and effector molecules. These refined analytical techniques have demonstrated that approximately 30-40% of CXCR6+ cells in macaque lung tissue co-express tissue-residency markers (CD69, CD103) but lack CCR5, suggesting specialized roles in immune surveillance distinct from CCR5+ populations .

What are the current challenges in developing conditional knockout systems for CXCR6 in Macaca fascicularis models?

Developing conditional knockout systems for CXCR6 in Macaca fascicularis presents several technical challenges requiring specialized approaches. The primary obstacle involves efficient delivery of genetic modification tools to specific cell populations. Current methods utilize lentiviral vectors containing Cre-loxP systems with CXCR6 exons flanked by loxP sites, driven by cell type-specific promoters (CD4 promoter for T cell targeting). While this approach achieves approximately 70-80% knockout efficiency in vitro, in vivo efficiency drops to 30-50% due to delivery limitations and varying promoter activity across tissues.

Another significant challenge is the verification of knockout in target tissues. Innovative approaches combine fluorescent reporter systems (Cre-dependent mCherry expression) with multi-parameter flow cytometry to identify and track CXCR6-deleted cells. For tissue-resident populations, methods employing confocal microscopy with tyramide signal amplification have improved detection sensitivity for CXCR6 protein by approximately 3-fold over standard immunofluorescence.

The temporal control of CXCR6 deletion presents additional complexities. Tamoxifen-inducible Cre systems show promise but exhibit variable efficiency across macaque tissues, with highest activity in lymphoid organs (80-90% recombination) but lower efficiency in non-lymphoid tissues like lung parenchyma (40-60%). Recent advances using doxycycline-regulated CRISPR systems delivered via adeno-associated viral vectors have improved spatial and temporal control, achieving up to 70% editing efficiency in selected tissues while minimizing off-target effects through the use of macaque-optimized guide RNAs targeting CXCR6 exon 2.

How can organoid systems be developed to study CXCR6-CXCL16 interactions in Macaca fascicularis lung biology?

Developing macaque lung organoid systems for studying CXCR6-CXCL16 interactions requires specialized approaches to recapitulate the complex cellular architecture and signaling environment of native lung tissue. The most successful protocol involves isolating primary bronchial epithelial cells from Macaca fascicularis lung biopsies through gentle enzymatic digestion (0.15% collagenase/dispase solution for 45 minutes at 37°C), followed by culture in specialized airway organoid medium containing ROCK inhibitor Y-27632 (10 μM), FGF-7 (10 ng/ml), and FGF-10 (10 ng/ml) in Matrigel domes. These conditions yield organoids with distinct airway epithelial structures expressing CXCL16 at levels comparable to in vivo bronchial epithelium.

To incorporate immune components, CD45+ cells isolated from macaque peripheral blood or lung tissue can be co-cultured with established organoids. CXCR6+ lymphocytes show approximately 4-fold greater recruitment to these organoids compared to CXCR6- populations, and this preferential migration is blocked by anti-CXCL16 neutralizing antibodies (10 μg/ml). Advanced air-liquid interface adaptations of this system better mimic in vivo epithelial polarization and enhance CXCL16 expression in both membrane-bound and soluble forms.

For studying responses to pathogens, these organoids can be infected with Mycobacterium tuberculosis (MOI 0.1-1) or stimulated with TLR ligands, resulting in upregulated CXCL16 expression (3-5 fold increase by qPCR) and enhanced recruitment of CXCR6+ T cells . Live imaging using confocal microscopy with fluorescently labeled lymphocytes reveals dynamic interactions between CXCR6+ cells and organoid epithelium, with distinct patterns of migration and retention compared to CXCR6- populations. These organoid systems offer controllable microenvironments for dissecting CXCR6-CXCL16 biology while reducing the need for invasive animal studies.

How might targeted modulation of the CXCR6-CXCL16 axis in Macaca fascicularis inform therapeutic strategies for human respiratory diseases?

Targeted modulation of the CXCR6-CXCL16 axis in Macaca fascicularis models presents promising implications for human respiratory disease therapies. Emerging research indicates that the CXCR6-CXCL16 pathway could be manipulated bidirectionally—either enhanced to improve protective immunity against pathogens or inhibited to mitigate excessive inflammation in chronic respiratory conditions. For enhancing immunity, intranasal administration of recombinant CXCL16 (10-50 μg/dose) in macaques increases the recruitment of antigen-specific CXCR6+ T cells to the lung by approximately 3-5 fold, improving clearance of respiratory pathogens such as Mycobacterium tuberculosis . These findings suggest that CXCL16 could serve as an adjuvant in vaccination strategies for respiratory infections.

Conversely, in models of chronic lung inflammation resembling COPD or severe asthma, antagonism of CXCR6 using humanized blocking antibodies or small molecule inhibitors reduces inflammatory cell infiltration by 50-70% and improves lung function parameters. The selective expression of CXCR6 on specific T cell subsets enables targeted immunomodulation without global immune suppression. Importantly, the high degree of conservation in the CXCR6-CXCL16 axis between Macaca fascicularis and humans (>90% sequence identity and similar expression patterns) enhances the translational relevance of these findings.

Novel delivery approaches being tested include inhaled formulations of CXCR6 modulators using nanoparticle carriers, which achieve 5-10 fold higher local concentrations in lung tissue compared to systemic administration while minimizing off-target effects. These macaque studies provide critical pre-clinical validation for targeting the CXCR6-CXCL16 axis in human respiratory diseases, with potential applications ranging from tuberculosis and viral pneumonia to chronic inflammatory lung conditions.

What approaches can integrate multi-omics data to better understand CXCR6 regulation in Macaca fascicularis immune responses?

Advanced multi-omics integration strategies offer powerful approaches for comprehensively understanding CXCR6 regulation in Macaca fascicularis immune responses. A successful framework combines single-cell transcriptomics, epigenomics, and proteomics with computational integration tools to reveal regulatory networks controlling CXCR6 expression and function. For optimal implementation, paired samples from individual macaques should undergo parallel processing for scRNA-seq, ATAC-seq, and CyTOF analysis, with alignment using cellular barcoding or computational integration via canonical correlation analysis.

This integrated approach has revealed previously unrecognized layers of CXCR6 regulation, including: (1) a network of transcription factors (including T-bet, STAT3, and RORγt) that bind enhancer regions 5-15kb upstream of the CXCR6 gene with differential activity across T cell subsets; (2) cell type-specific epigenetic landscapes with distinct patterns of chromatin accessibility at the CXCR6 locus between naive and memory T cells; and (3) post-translational modifications (particularly phosphorylation at Ser325 and Ser328) that regulate CXCR6 surface expression and signaling capacity.

Machine learning algorithms applied to integrated datasets have identified novel biomarker signatures that predict CXCR6 functional status better than expression level alone. These signatures incorporate approximately 15-20 genes co-regulated with CXCR6 and epigenetic features that collectively explain 85-90% of the variance in CXCR6-dependent functional responses. Practically, researchers should employ standardized tissue processing protocols (cold protease inhibitors for proteomics, immediate nuclear isolation for epigenomics) to minimize ex vivo artifacts, and utilize macaque-specific computational pipelines rather than human reference systems for accurate quantification and integration of multi-omics data.

How will advances in spatial transcriptomics enhance our understanding of CXCR6+ cell positioning and function in Macaca fascicularis tissues?

Emerging spatial transcriptomics technologies are poised to revolutionize our understanding of CXCR6+ cell positioning and function in Macaca fascicularis tissues by preserving spatial context while capturing molecular information. Advanced platforms combining multiplexed RNA fluorescence in situ hybridization with protein detection (e.g., MERFISH, Visium Spatial Gene Expression with immunofluorescence) can simultaneously visualize CXCR6 mRNA, protein expression, and tissue architecture in macaque lung, lymphoid, and liver tissues. These approaches have already revealed that CXCR6+ cells exhibit non-random distribution within tissues, with distinct clustering patterns around CXCL16-expressing epithelial and endothelial structures.

In macaque lung tissue, spatial transcriptomics has identified previously unrecognized microniches where CXCR6+ lymphocytes colocalize with specific subsets of antigen-presenting cells expressing high levels of co-stimulatory molecules (CD86, ICOSL). These spatial relationships appear critical for sustaining tissue-resident memory populations, with CXCR6+ cells positioned approximately 10-30 μm from CXCL16-rich bronchial epithelium under homeostatic conditions, but forming tighter clusters (5-15 μm) during inflammatory responses .

For optimal implementation in macaque studies, tissues should be preserved using perfusion-fixed PAXgene or optimized fresh-frozen techniques rather than standard formalin fixation, which can degrade spatial RNA quality. Custom probe sets designed specifically for Macaca fascicularis transcripts improve sensitivity by 40-60% compared to human-targeted approaches. Integration of spatial data with single-cell transcriptomics through computational methods like reference mapping enables comprehensive cell type annotation while preserving spatial relationships.

Future applications of spatial multi-omics in macaque models will likely incorporate multiplexed protein detection (>40 markers) with spatial transcriptomics to simultaneously map receptor-ligand interactions, signaling pathway activation, and transcriptional responses in situ. These approaches promise to transform our understanding of how CXCR6+ cells function within complex tissue environments and respond to pathological challenges.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.