Recombinant Macaca fascicularis Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Macaca fascicularis Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Macaca fascicularis Cytochrome c oxidase subunit 2 (MT-CO2) is a recombinant protein derived from the crab-eating macaque, a species of macaque commonly used in biomedical research. This protein is part of the cytochrome c oxidase complex, which plays a crucial role in the electron transport chain during oxidative phosphorylation in mitochondria. The MT-CO2 subunit is encoded by the mitochondrial gene MT-CO2 and is essential for the proper functioning of the enzyme, facilitating the transfer of electrons to oxygen and contributing to ATP production.

Structure and Function

The recombinant MT-CO2 protein from Macaca fascicularis is a full-length protein consisting of 227 amino acids. It is typically expressed in E. coli and may be tagged with various affinity tags to facilitate purification. The structure of MT-CO2 includes several key domains that are crucial for its interaction with other subunits of cytochrome c oxidase and for its enzymatic activity.

Protein CharacteristicsDescription
SpeciesMacaca fascicularis (Crab-eating macaque)
Gene NameMT-CO2
Protein Length227 amino acids
Expression SystemE. coli
Tag TypeDetermined during production
Storage BufferTris-based buffer, 50% glycerol

Research Applications

Recombinant MT-CO2 from Macaca fascicularis is used in various research applications, including studies on mitochondrial function, oxidative phosphorylation, and neurodegenerative diseases. The protein can be used in ELISA assays to detect antibodies against MT-CO2 or to study protein-protein interactions.

ELISA Assays

ELISA kits for recombinant Macaca fascicularis MT-CO2 are available, allowing researchers to quantify the protein or antibodies against it in samples. These assays are useful for studying immune responses or for detecting MT-CO2 in biological samples.

ELISA Kit DetailsDescription
Quantity50 µg (other quantities available upon request)
Product TypeRecombinant Protein
SpeciesMacaca fascicularis
Uniprot NumberP11948
Storage Conditions-20°C or -80°C for extended storage

Mitochondrial Disorders

Mitochondrial disorders often result from mutations in genes encoding components of the electron transport chain, including cytochrome c oxidase. These disorders can lead to a range of clinical symptoms, including muscle weakness, neurological deficits, and metabolic disturbances.

Neurodegenerative Diseases

Mitochondrial dysfunction is implicated in the pathogenesis of neurodegenerative diseases such as Parkinson's disease and Alzheimer's disease. Research on mitochondrial proteins like MT-CO2 can provide insights into the mechanisms underlying these diseases and potential therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Names
Target Protein Sequence
MAHPVQLSLQDATSPIMEELITFHDHAFMAMSLISFLVLYALALTLTTKLTNTNITDAQE METIWTILPAVILILIALPSLRVLYLTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLKPGDLRLLEVDNRVVLPIEAPVRMMITSQDVLHSWTIPTLGLKTDAVPGRLN QTVFTATRPGVYYGQCSEICGANHSFMPIVADLIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This respiratory chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme a3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Cytochrome c Oxidase Subunit 2 (MT-CO2) and what is its significance in Macaca fascicularis?

    Cytochrome c oxidase subunit 2 (MT-CO2) is one of the three mitochondrial DNA (mtDNA) encoded subunits of respiratory complex IV. In Macaca fascicularis (crab-eating macaque), as in other mammals, MT-CO2 plays a crucial role in the electron transport chain of oxidative phosphorylation. This protein contains a binuclear copper A center (CuA) that receives electrons from cytochrome c and transfers them to the catalytic center of the enzyme . The significance of studying MT-CO2 in M. fascicularis lies in its evolutionary conservation and its potential as a model for human mitochondrial function and pathologies.

  • How does MT-CO2 function within the mitochondrial respiratory chain?

    MT-CO2 functions as an integral component of cytochrome c oxidase (Complex IV), which represents the terminal complex of the electron transport chain. Methodologically, the process operates as follows:

    • Electrons originate from reduced cytochrome c in the intermembrane space

    • These electrons are transferred via the dinuclear copper A center (CuA) of MT-CO2

    • The electrons then move through heme A of subunit 1 to the active site

    • At the binuclear center formed by heme A3 and copper B (CuB), molecular oxygen is reduced to water

    • This process utilizes 4 electrons from cytochrome c and 4 protons from the mitochondrial matrix

    This electron transfer contributes to the electrochemical gradient that drives ATP synthesis, forming the basis of cellular energy production.

  • What are the structural characteristics of recombinant MT-CO2 from Macaca fascicularis?

    Recombinant M. fascicularis MT-CO2 typically consists of 227 amino acids with a molecular weight of approximately 25.6 kDa . The structure includes:

    • An N-terminal domain containing two transmembrane alpha-helices

    • A conserved cysteine loop at positions 196 and 200, which forms part of the CuA center

    • A conserved histidine at position 204 that also contributes to the CuA center

    When expressed as a recombinant protein, MT-CO2 is often tagged (commonly with His-tag) to facilitate purification and detection in experimental settings .

Advanced Research Questions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.